KEGG   Emticicia oligotrophica: Emtol_2090Help
Entry
Emtol_2090        CDS       T02272                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eol  Emticicia oligotrophica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_2090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emtol_2090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emtol_2090
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Emtol_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2126579..2127358
Genome map
AA seq 259 aa AA seqDB search
MNRITKLFQEKPNNVLNIYFTAGFPSLNNTVAVLEALQEAGADIAEIGMPYSDPVADGET
IQQSNQVALENGMSLKVLFEQLQGARTKVSLPIILMGYINPVLQFGLEAFCQKCQEVGVD
GLILPDLPMDEYYEEYKPIFDKYGLLNIFLITPQTSEQRIRRIDEISNGFIYMVSSASVT
GGTSGITDTMEAYFNRVNAMNLRNPRLIGFGIKDNATFTKASQYAAGAIIGSQFIRVLQN
SSQETLHQDIVSYIKAVKG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattaccaagcttttccaagaaaagcccaacaatgtattaaacatatatttt
actgcaggatttccaagtcttaataatacagtagcagtactcgaagctttgcaagaagca
ggtgccgatattgccgaaatcggaatgccttactccgaccctgttgccgatggtgaaact
attcaacagtcaaaccaagtggctctcgaaaatggcatgagtttgaaagtgcttttcgag
caacttcaaggagcaagaacgaaagtctctttacctattatattaatgggttatatcaat
cctgttctccaatttggtttagaagccttttgtcaaaaatgtcaagaggttggagtcgat
ggcctaatcttacccgatttgccaatggatgagtattacgaagaatacaaacctattttc
gataagtatggtttgttaaatatcttcctaataacacctcaaacttccgagcaacgtatc
agaagaattgatgaaatttctaatggctttatatatatggtaagtagtgccagtgtaacg
ggaggaacttcgggtattaccgatacaatggaagcttatttcaatcgagtaaatgctatg
aatcttcgtaaccctcgcctcattggctttggtatcaaagataatgcgactttcactaag
gcaagccagtacgctgcaggtgcaattattggaagccagtttattagagtgttacaaaat
tcctcgcaagagaccctacaccaagatatagtttcttatattaaggctgtgaaaggctaa

DBGET integrated database retrieval system