KEGG   Emticicia oligotrophica: Emtol_2090Help
Entry
Emtol_2090        CDS       T02272                                 

Definition
Tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eol  Emticicia oligotrophica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_2090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emtol_2090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Emtol_2090
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Emtol_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126579..2127358
Genome map
AA seq 259 aa AA seqDB search
MNRITKLFQEKPNNVLNIYFTAGFPSLNNTVAVLEALQEAGADIAEIGMPYSDPVADGET
IQQSNQVALENGMSLKVLFEQLQGARTKVSLPIILMGYINPVLQFGLEAFCQKCQEVGVD
GLILPDLPMDEYYEEYKPIFDKYGLLNIFLITPQTSEQRIRRIDEISNGFIYMVSSASVT
GGTSGITDTMEAYFNRVNAMNLRNPRLIGFGIKDNATFTKASQYAAGAIIGSQFIRVLQN
SSQETLHQDIVSYIKAVKG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattaccaagcttttccaagaaaagcccaacaatgtattaaacatatatttt
actgcaggatttccaagtcttaataatacagtagcagtactcgaagctttgcaagaagca
ggtgccgatattgccgaaatcggaatgccttactccgaccctgttgccgatggtgaaact
attcaacagtcaaaccaagtggctctcgaaaatggcatgagtttgaaagtgcttttcgag
caacttcaaggagcaagaacgaaagtctctttacctattatattaatgggttatatcaat
cctgttctccaatttggtttagaagccttttgtcaaaaatgtcaagaggttggagtcgat
ggcctaatcttacccgatttgccaatggatgagtattacgaagaatacaaacctattttc
gataagtatggtttgttaaatatcttcctaataacacctcaaacttccgagcaacgtatc
agaagaattgatgaaatttctaatggctttatatatatggtaagtagtgccagtgtaacg
ggaggaacttcgggtattaccgatacaatggaagcttatttcaatcgagtaaatgctatg
aatcttcgtaaccctcgcctcattggctttggtatcaaagataatgcgactttcactaag
gcaagccagtacgctgcaggtgcaattattggaagccagtttattagagtgttacaaaat
tcctcgcaagagaccctacaccaagatatagtttcttatattaaggctgtgaaaggctaa

DBGET integrated database retrieval system