KEGG   Emticicia oligotrophica: Emtol_2421Help
Entry
Emtol_2421        CDS       T02272                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eol  Emticicia oligotrophica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Emtol_2421
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Emtol_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2508558..2509133
Genome map
AA seq 191 aa AA seqDB search
MFIEPKRGRNQEQKSGWIEVVCGSMFSGKTEELIRRLKRAKIAKQKVEIFKPSIDVRYHE
VDIVSHNQTAIRSTPVHTSEEILLMTTDCEVVGIDEAQFFDNGIIAVVNKLAENGKRVIV
AGLDMDSRGIPFGPMPALMSIAEYVTKVHAICVVCGDIANYSYRKVPNEQQVMLGESDSY
EARCRKCFHAG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagaacccaaaagaggtagaaatcaagaacaaaagtcaggctggattgaggta
gtttgtggctcaatgttctccggaaagaccgaagaattaattcgtaggttgaagcgtgcc
aaaattgccaaacagaaggtagaaatttttaagccttcaattgatgtgcgttatcatgaa
gtagatattgtttcacataaccagacagccattcgctctacaccagttcatacatcagaa
gaaattttgttgatgaccactgattgtgaagttgtaggtatagacgaagctcaatttttt
gataatggaattatagcggtagtaaataaacttgctgaaaatggcaagcgtgtaattgtg
gcgggtcttgatatggactcgcgtggaattcctttcggaccaatgcccgctttgatgtca
attgccgaatacgtaacgaaagtacatgccatttgtgtagtttgtggagatatcgctaat
tattcttatcgaaaagttcctaacgaacaacaagtaatgcttggagagtctgattcttat
gaagctcgttgccgtaaatgctttcatgcagggtga

DBGET integrated database retrieval system