KEGG   Emticicia oligotrophica: Emtol_2798Help
Entry
Emtol_2798        CDS       T02272                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
eol  Emticicia oligotrophica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Emtol_2798
DNA repair and recombination proteins [BR:eol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Emtol_2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2983929..2984534)
Genome map
AA seq 201 aa AA seqDB search
MNFPSKLIEEAVIEISKLPGIGKKSALRMALHLLKRDESQTLLLADALTAMRTKTTYCKQ
CHNISDEELCLICSSPRRDTSVICIVEDTRDVLAIENTAQYRGLYHILGGIISPLMGIGP
NDLHIESLIRRVEQNAEIQEIILALSPTMEGDTTAFYLQKKLKPFGKKISTIARGIPIGG
DLEYADEVTLGRSIISRVSYE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcccctcaaaactgatagaagaagcggtaattgaaatatcaaagctacctgga
attggcaagaaatctgctttgagaatggcacttcacttactgaaacgtgatgaatcacag
acattactcttagctgatgcccttacagcaatgcgaaccaagaccacttactgtaaacaa
tgccataatatatctgatgaagaactatgccttatttgtagttctccacgccgcgatacc
tcagtcatttgcatagttgaagacacacgcgatgtattagccattgaaaatacagctcag
tatcgcggtctatatcatattttaggaggaattatttcacctttgatgggtattggccct
aacgaccttcacatagaatcgcttattagaagagttgagcaaaacgctgaaattcaagag
attattttggctctcagcccaactatggagggcgatacaacggcattttacttacaaaaa
aagcttaagcctttcgggaaaaaaatcagtactatagctcgtggaatcccgattggagga
gatttagaatatgccgatgaagttacccttgggcgtagtattattagtcgcgtatcttat
gaatag

DBGET integrated database retrieval system