KEGG   Emticicia oligotrophica: Emtol_2859Help
Entry
Emtol_2859        CDS       T02272                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
eol  Emticicia oligotrophica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Emtol_2859
Enzymes [BR:eol01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Emtol_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045657..3047171)
Genome map
AA seq 504 aa AA seqDB search
MAFDKNILKIKTLGELKASGYKPKSIKQELRDNLVEKLKNKETVFPGIWGYEDTVIPEVE
KAILSMHHINLLGLRGQAKTRIARLMVNLLDEYVPVVEGSELNDDPLEPLSRFAKDLITE
KGDDTPISWLPRAERYNEKLATPDVSIADLIGDVDPIKAATLRLPYSDERVIHFGMIPRS
HRCIFVINELPDLQARIQVSLFNILQEGDIQIRGFKLRMPLDIQFVFTANPEDYTNRGSI
VTPLKDRIDSQIVTHYPKSIEIGRKITEQEAIIKDGQKKIVVNDILKDLVEQIAVEARQS
EYVDAKSGVSARMTISAYENLLSSAERRALINGEKNINARLADIYGAIAAINGKIELVYE
GEVEGPVYVAQSLIGKAIRTEFLKYFPNPEAVKKKKSGKNPFQQVSNWFGEGNIIDFDND
LTDREYRARLKTIEGLEELVESYHQHLAENDKLFMMEFALHGLAEYSLISKQNLDTGLQF
KDLLDSMFDPNKMNFGDDDEDDFR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgataagaatattttaaagataaaaacactcggcgaactaaaagctagtggt
tataaaccaaaatctatcaaacaagaacttcgagataatttagttgaaaaacttaaaaat
aaagaaacggtttttcccggtatttggggatatgaagataccgtaattccagaagttgaa
aaggcaattttatccatgcaccacatcaatcttttgggtttgcgtggacaagcaaaaaca
cgtattgctcgcctaatggtaaatcttttggacgaatatgttccagttgtggaaggttcc
gaactcaatgatgacccacttgaaccactttctcgatttgcaaaagatttgattactgaa
aaaggcgatgacacgcctatttcttggttacctcgtgcagaacgttataacgaaaaattg
gctacgcctgatgtctcgattgccgatttaattggtgatgttgaccccattaaggcagca
actctacgcttaccctattccgatgaacgtgtgattcatttcggtatgattccacgctcc
caccgctgtatttttgtaattaacgaattgccagatttacaagctcgtattcaagtttcg
ttgtttaatattctacaagaaggcgatattcagattcgtggatttaaacttcgtatgcct
ctcgatattcaatttgtttttacggcaaaccctgaagattatacgaatcgtggaagtatc
gtaacaccgctcaaagaccgtattgatagccagattgtgactcactatccgaaatctatt
gaaatcggacgaaaaattaccgagcaagaagctatcattaaagatggtcaaaagaaaatc
gtggttaatgatattctaaaagatttggttgaacaaattgcagttgaagcacgccaaagc
gagtatgttgatgccaaaagtggcgtttctgctcgtatgaccatctctgcttatgaaaat
ctattaagttcggctgaaagaagagcattaatcaacggagaaaaaaatatcaatgcacgt
ttggctgatatttacggtgccatcgctgccatcaatggtaaaatagaattagtctatgag
ggtgaagttgaaggcccagtttatgtagctcaaagtttaatcggaaaggctattcgaacc
gaatttttaaaatatttccctaatcccgaggctgtaaagaaaaagaaatcgggtaaaaac
ccattccagcaggtgtcaaattggttcggcgaaggaaatatcatagattttgacaatgac
cttacagatagagagtatcgtgcaagactaaaaaccattgagggtttagaagaattagta
gaaagttatcaccaacacttagctgaaaatgataaacttttcatgatggagtttgccctg
catggcttagcagaatactcgctcatcagcaagcaaaatttagatactggtttacaattc
aaagatttattggatagtatgttcgaccccaataaaatgaattttggtgatgatgacgaa
gatgattttagataa

DBGET integrated database retrieval system