KEGG   Emticicia oligotrophica: Emtol_3077Help
Entry
Emtol_3077        CDS       T02272                                 

Definition
glycoside hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
eol  Emticicia oligotrophica
Brite
Enzymes [BR:eol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Emtol_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3317070..3318215
Genome map
AA seq 381 aa AA seqDB search
MNSFYKIATRITFLLVITLFHSQAQVLKTVYKDAFKIGCAVNPAIVSGKDSAAQKIVLKH
FNTITVENVMKAALINPQPGIFNFGPADDFVAFGKKNNMFIIGHTLVWHNQTPDWFFQDE
KGKLKSKEAVAERLKEHIRAVAGRYAGKVDAWDVVNEVMGEDGKYRSTTWVNGIGDGDEL
VKLSFKYAAEFAPNTELYYNDFNAWRPEKRDGIVRMVKMLQKEGIRIDGIGIQGHWGLNY
PKTEYIEAAIDAYAALGLKVMITELDVDVLPLTKEGQIIGTGMSHPQFQLEEFKTYLDPY
QNGLPADIQQKLANRYAELFQIFYKKRDKIDRVTLWGVQDAMSWKNDYPIPNRTNYPLLF
DRKYQAKPALKAVLEVPKKNK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaactcattttataaaattgcaactcgaattacttttttattagtcatcacacttttt
cattctcaagcacaagtattaaaaactgtctataaagatgcctttaaaataggttgtgct
gttaaccctgccattgtttcgggcaaagatagtgctgctcagaaaatcgttttaaagcat
tttaatacgattacagtagaaaatgtcatgaaagccgcactcattaatccacaaccagga
atattcaactttggtccagcagatgattttgtggctttcggaaaaaaaaataatatgttt
atcattgggcatacattggtttggcataaccaaacacccgattggttttttcaagatgaa
aagggtaagcttaaaagcaaagaggcagttgccgaacgcctaaaagagcacattagagct
gttgctggaaggtatgcaggaaaggtagatgcttgggatgtagtaaatgaagtgatggga
gaagatggaaagtatcgttcaacaacttgggtaaatggtattggagatggagatgaatta
gtgaaactttcctttaaatatgctgctgaatttgcacctaatactgagctttactataat
gattttaatgcttggagacccgaaaaacgtgatggaatagtacgtatggtgaaaatgctt
caaaaagaaggcatcagaattgatggtattggtattcaaggccactgggggcttaattat
cctaaaactgaatatattgaagctgctattgatgcttatgctgctttaggattaaaggta
atgataaccgaacttgatgtggatgtattaccattaactaaagaaggacaaattataggt
acaggaatgtcgcatccacagtttcagttagaggaatttaagacttatctcgacccttat
caaaatggattaccagctgatattcagcaaaaattagccaatagatatgcagagttattt
cagattttctacaaaaaaagagataaaatcgaccgtgtaacgctttggggcgtacaagat
gctatgtcatggaagaatgattacccgattcccaaccgcacgaactacccattgttattt
gatagaaagtatcaagccaaaccagctttaaaagcagtactggaagttccaaaaaaaaat
aagtaa

DBGET integrated database retrieval system