KEGG   Emticicia oligotrophica: Emtol_3125Help
Entry
Emtol_3125        CDS       T02272                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eol  Emticicia oligotrophica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_3125
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Emtol_3125
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Emtol_3125
Enzymes [BR:eol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Emtol_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3368609..3369919
Genome map
AA seq 436 aa AA seqDB search
MKLYSTNHQSPDVDLAEAVFRGLPPDNGLYMPTEFKPLPSSFWDNVQNLSLQEIAFEIAH
ALIGEDVPTEDLRQLINRAIDFEAPIVKVEENTYCLELFHGPSMAFKDFGARFMAALMSY
FLQKSQKQIHILVATSGDTGGAVAQGFYKTPNIDVTILYPSGKVSDIQEKQLTTLGENVR
ALEVSGTFDDCQKLVKQAFLDKDLTSKFDLASANSINIARLIPQAFYYVSTYAQLKKSGA
DLPVVISVPSGNFGNLSAGIIAWRLGMPIKKFIATTNVNNVVPTYLESGIYEPISPSLST
ISNAMDVGNPSNFPRMKALLDNDLEKMKELVAGYYYNDDATRAAMKDVYERTGYVMCPHT
AVAYLGLKSYTNTLNEPVSGVFLSTAHYAKFLDVVEEVVGKQDIPQRLSDLLSLEKQATP
ISTNFADFKAWLMENL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacagcacaaaccaccaaagtccagatgtagatttagcagaagccgtattt
cgtggacttcctcccgataatggactttatatgcctactgaatttaaacctttgccttcg
tctttttgggataacgttcagaacttaagtctgcaagaaattgccttcgaaattgcccac
gcactaattggagaggatgttccaactgaagaccttcgccaattaatcaatcgagcgata
gattttgaagcaccaattgtaaaagttgaagaaaatacctactgtttagagctttttcat
ggcccgtcaatggcatttaaagattttggagcaagatttatggctgctttaatgtcgtat
tttctccaaaaatctcaaaagcagattcatattttagtagccacttcgggtgataccggt
ggtgcggtggctcaaggtttttacaaaactcctaatattgatgtaacgattctttatccg
agcggcaaagtaagtgatattcaagaaaaacaattaactactcttggagaaaatgtaaga
gctttggaagtgtcaggtacgtttgatgattgtcaaaaattagttaaacaagctttttta
gacaaagaccttacttcgaaattcgacttagcttcggcaaattcgattaatatagctcgc
ttaattccacaagcattttattatgtaagtacctatgctcaactaaaaaaatcgggtgcc
gatttaccagttgttatttctgtaccaagcggtaactttggtaatttgagtgcaggaatt
attgcatggcgtttgggaatgccaattaagaaatttattgctactaccaacgtaaataat
gtagtgcctacttatttagaaagtggtatttacgagcctataagcccttcattatcaacg
atttccaatgcaatggatgtgggtaatccgagtaattttcctcgtatgaaagcattgctt
gataatgatttggaaaaaatgaaagaactggtagctggttattattataatgatgatgct
acgcgtgctgccatgaaagatgtttatgagcgtacaggatacgtgatgtgtccacacact
gctgttgcctatttaggtttaaaatcctataccaatacattgaatgaaccagtaagtggt
gtatttttgtctacggcacattatgctaaattcttagacgttgtagaggaagtggttgga
aagcaggatattcctcagcgtctttctgatttattaagtctagaaaaacaagcgactcca
atatcaactaattttgctgatttcaaagcttggttgatggagaatttataa

DBGET integrated database retrieval system