KEGG   Emticicia oligotrophica: Emtol_3305Help
Entry
Emtol_3305        CDS       T02272                                 

Definition
(GenBank) Ig family protein
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eol  Emticicia oligotrophica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Emtol_3305
  Lipid metabolism
   00561 Glycerolipid metabolism
    Emtol_3305
   00600 Sphingolipid metabolism
    Emtol_3305
Enzymes [BR:eol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Emtol_3305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3598612..3600630)
Genome map
AA seq 672 aa AA seqDB search
MIKIPKLLLLLSFFVHTSISAQQTKTVWLDDLLIQTFSEGLRPVQAKKNYSNDTLRINGK
KYSRGLGAQSPCVLVFLLNKQATRFSALIGTDDLGNKEIALTFYVVGDGKVLFASKEMKI
GDDPIKIDLNLMGIKQLGLLVTDKVGGINNKRTYCNWIDAQLEMIGDAKPEHTVNTDEKY
ILTPPTGKSPKINSAKLFGATPNNPFLYTIAATGERPMTFSAINLPRGLALDKQTGIISG
KVSERGTYQTTLKAQNVFGEATKSLTIKIGDTIAFTPPIGWNGWNSWEAHIDREKVIASA
DAMVKTGLRDHGWTYINIDDAWQGVRGGPNLALQPNEKFPDIKGMFDYIHSLGLKVGLYS
TPYISSYGGYTGASSDFEKGGESHQSIMVDRRAFNHIAKYRFETVDAKQMADWGTDFLKY
DWRIDVNSTERMATALKQSGRDIVFSISNNAPFEKVNDWVRLTNMYRTGPDIKDSWTSLF
LNTFSLDKWSPYTGHGHWADPDMMIVGKVSIGPIMHDTRLTPDEQYSHVSIFSLLDAPLL
IGCPIEQLDAFTLNLLSNDEVIEINQDPLGKGGRLLLEENGIQVWVKPLEDGSSAVGLFN
TGNYGKTPESYFNWGNETAKSFTFDFAKVGLQGKFNLRDVWRQKNLGTFNGSFSTEIRHH
GVVMLRMFPQKR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatacccaaacttctattacttctttccttttttgtgcatacgagtatttcg
gcacagcagaccaaaaccgtatggttggacgatttattgattcaaacattttctgaaggt
cttcgccccgtacaagcaaaaaaaaattattcaaacgatactttacgaatcaatggaaag
aagtattcaagaggtttgggggctcaatctccttgtgtgttggtctttttattaaacaaa
caagctactcgtttttcagcattgattggaactgatgatttaggaaataaagaaatcgcc
ctcacattctatgtagttggcgatggaaaagtgctatttgcaagtaaggaaatgaagatt
ggcgatgacccaatcaaaattgacctcaatcttatgggaatcaaacaacttggcttgttg
gtaaccgataaagtaggtggcattaataataaacgaacttactgcaattggattgatgca
caattggaaatgattggcgatgccaagcccgaacacacggtaaacactgatgaaaagtat
attcttacgccaccgacaggtaaaagtcctaaaataaattcagctaaacttttcggggct
acccccaacaatccatttctctacaccatagctgctactggcgaacggccaatgactttt
tcggccattaaccttccgagaggccttgcacttgacaaacaaacaggcattattagcggt
aaagtaagcgaacgtggcacgtatcaaactacactcaaagcacaaaacgtattcggtgaa
gcaaccaaatcattaactatcaagataggtgataccattgcttttacgccacccattggt
tggaatggctggaattcgtgggaggctcacattgatagagagaaagtaattgcctcagcc
gatgcaatggtaaaaacaggtctgcgtgaccatggctggacttacatcaacatagatgat
gcttggcaaggcgtacgtggtggcccaaatttagcactacaacccaacgaaaaatttcca
gacataaaaggaatgttcgactacattcactcacttggcttaaaagtagggctttattca
actccttatatttcaagttatggtggttatactggagcttcttctgattttgaaaaaggt
ggcgagtctcatcagtctatcatggtcgatagaagagcatttaaccacattgcaaaatat
agatttgaaacagttgatgccaaacaaatggccgattggggaactgatttcttgaaatat
gattggcgtattgatgtaaactctaccgaacgcatggctactgccttgaagcaatcgggg
cgtgatatcgtgtttagtatttcaaataacgctccttttgagaaggtaaacgattgggta
agactaacgaatatgtaccgaacaggcccagacattaaagatagctggacgagccttttt
cttaataccttctcgctcgataaatggtctccttatacagggcatgggcattgggcagac
cccgacatgatgattgttggtaaagtttcgattggcccaattatgcacgacacccgccta
acacccgacgaacaatacagccacgtgagtatttttagcttattggatgcccccctactc
attggctgcccgattgaacagctcgatgctttcacgctcaatcttttatctaacgatgaa
gttatcgaaataaatcaagacccactcggcaaaggtggtaggcttttattggaagaaaat
ggcatacaagtttgggtaaagcccttagaagatggttcctctgccgtcggacttttcaat
actggaaattatggcaaaacgcccgaatcttatttcaattggggcaatgaaacagcgaag
tcgtttacatttgattttgcgaaagttggcttgcaaggcaaattcaacttacgagatgtg
tggcgtcagaaaaatttagggacctttaatggttcttttagcaccgaaattcgtcatcat
ggggtcgtaatgctcagaatgtttcctcaaaaacgctaa

DBGET integrated database retrieval system