KEGG   Emticicia oligotrophica: Emtol_3305Help
Entry
Emtol_3305        CDS       T02272                                 

Definition
Ig family protein
Organism
eol  Emticicia oligotrophica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598612..3600630)
Genome map
AA seq 672 aa AA seqDB search
MIKIPKLLLLLSFFVHTSISAQQTKTVWLDDLLIQTFSEGLRPVQAKKNYSNDTLRINGK
KYSRGLGAQSPCVLVFLLNKQATRFSALIGTDDLGNKEIALTFYVVGDGKVLFASKEMKI
GDDPIKIDLNLMGIKQLGLLVTDKVGGINNKRTYCNWIDAQLEMIGDAKPEHTVNTDEKY
ILTPPTGKSPKINSAKLFGATPNNPFLYTIAATGERPMTFSAINLPRGLALDKQTGIISG
KVSERGTYQTTLKAQNVFGEATKSLTIKIGDTIAFTPPIGWNGWNSWEAHIDREKVIASA
DAMVKTGLRDHGWTYINIDDAWQGVRGGPNLALQPNEKFPDIKGMFDYIHSLGLKVGLYS
TPYISSYGGYTGASSDFEKGGESHQSIMVDRRAFNHIAKYRFETVDAKQMADWGTDFLKY
DWRIDVNSTERMATALKQSGRDIVFSISNNAPFEKVNDWVRLTNMYRTGPDIKDSWTSLF
LNTFSLDKWSPYTGHGHWADPDMMIVGKVSIGPIMHDTRLTPDEQYSHVSIFSLLDAPLL
IGCPIEQLDAFTLNLLSNDEVIEINQDPLGKGGRLLLEENGIQVWVKPLEDGSSAVGLFN
TGNYGKTPESYFNWGNETAKSFTFDFAKVGLQGKFNLRDVWRQKNLGTFNGSFSTEIRHH
GVVMLRMFPQKR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatacccaaacttctattacttctttccttttttgtgcatacgagtatttcg
gcacagcagaccaaaaccgtatggttggacgatttattgattcaaacattttctgaaggt
cttcgccccgtacaagcaaaaaaaaattattcaaacgatactttacgaatcaatggaaag
aagtattcaagaggtttgggggctcaatctccttgtgtgttggtctttttattaaacaaa
caagctactcgtttttcagcattgattggaactgatgatttaggaaataaagaaatcgcc
ctcacattctatgtagttggcgatggaaaagtgctatttgcaagtaaggaaatgaagatt
ggcgatgacccaatcaaaattgacctcaatcttatgggaatcaaacaacttggcttgttg
gtaaccgataaagtaggtggcattaataataaacgaacttactgcaattggattgatgca
caattggaaatgattggcgatgccaagcccgaacacacggtaaacactgatgaaaagtat
attcttacgccaccgacaggtaaaagtcctaaaataaattcagctaaacttttcggggct
acccccaacaatccatttctctacaccatagctgctactggcgaacggccaatgactttt
tcggccattaaccttccgagaggccttgcacttgacaaacaaacaggcattattagcggt
aaagtaagcgaacgtggcacgtatcaaactacactcaaagcacaaaacgtattcggtgaa
gcaaccaaatcattaactatcaagataggtgataccattgcttttacgccacccattggt
tggaatggctggaattcgtgggaggctcacattgatagagagaaagtaattgcctcagcc
gatgcaatggtaaaaacaggtctgcgtgaccatggctggacttacatcaacatagatgat
gcttggcaaggcgtacgtggtggcccaaatttagcactacaacccaacgaaaaatttcca
gacataaaaggaatgttcgactacattcactcacttggcttaaaagtagggctttattca
actccttatatttcaagttatggtggttatactggagcttcttctgattttgaaaaaggt
ggcgagtctcatcagtctatcatggtcgatagaagagcatttaaccacattgcaaaatat
agatttgaaacagttgatgccaaacaaatggccgattggggaactgatttcttgaaatat
gattggcgtattgatgtaaactctaccgaacgcatggctactgccttgaagcaatcgggg
cgtgatatcgtgtttagtatttcaaataacgctccttttgagaaggtaaacgattgggta
agactaacgaatatgtaccgaacaggcccagacattaaagatagctggacgagccttttt
cttaataccttctcgctcgataaatggtctccttatacagggcatgggcattgggcagac
cccgacatgatgattgttggtaaagtttcgattggcccaattatgcacgacacccgccta
acacccgacgaacaatacagccacgtgagtatttttagcttattggatgcccccctactc
attggctgcccgattgaacagctcgatgctttcacgctcaatcttttatctaacgatgaa
gttatcgaaataaatcaagacccactcggcaaaggtggtaggcttttattggaagaaaat
ggcatacaagtttgggtaaagcccttagaagatggttcctctgccgtcggacttttcaat
actggaaattatggcaaaacgcccgaatcttatttcaattggggcaatgaaacagcgaag
tcgtttacatttgattttgcgaaagttggcttgcaaggcaaattcaacttacgagatgtg
tggcgtcagaaaaatttagggacctttaatggttcttttagcaccgaaattcgtcatcat
ggggtcgtaatgctcagaatgtttcctcaaaaacgctaa

DBGET integrated database retrieval system