KEGG   Emticicia oligotrophica: Emtol_3307Help
Entry
Emtol_3307        CDS       T02272                                 

Definition
Ig family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eol  Emticicia oligotrophica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eol00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eol00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:eol00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3602963..3604960)
Genome map
AA seq 665 aa AA seqDB search
MNKIIIFLAVLGLYTHSFAQTKSIWLDDLKIKSFSEGIPAVLGKTNAGGDSMKINGKLYK
HGVGVSSTSVLSFFLNGHATEFSAMVGVDDKGVKDLPLKFYVIGDRKILFESGEMKLGDA
PKQVKVSLVGVKRLGLLVTIEENGFNRSYSNWADAKFVMKDDFIPQTMPNTDEKYILTPK
PDKKPKINSPKLFGARPNNPFLYTIAATGERPMKFTAKNLPQGLSLDSKTGQITGKVAQK
GTYTSTLVAKNAFGEIKKELKIIIGDTIALTPPIGWNGWNSWARNIDREKVIASADAMIK
MGLNQHGWTYINIDDAWQGQRGGVFNAIQPNEKFPNFKEMADYIHSQGLKLGVYSTPMIT
SYAGYIGGSSDFVDGKITDSIKNNKRAFRYVGKYHFEENDAKQMATWGVDYLKYDWRIEV
PSAERMSAALKNSGRDIVYSISNSAPFSNAKDWAKLSNTFRTGPDIRDSWLSLYLSAFTL
DKWALYGGHGHWLDPDMMILGNVTTGSELHPTRLTPDEQYSHVSLFSLLSAPLLIGCPIE
QLDAFTLNLLTNDEVIEINQDPLGKPARLVSDDDGIQIWVKSLEDGSYAVGLFNIAHFGK
TPESYFRWGDEKSTNYVLKLNQIGLKGNFRIRDVWQQKDLGNFKNTFKTSIPHHGVIMLR
VFPKN
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataatcatttttcttgccgtattggggctatatacacacagctttgcccaa
acaaaatctatttggctcgatgacttgaaaattaaatcattttcagagggaattcctgcg
gttttaggtaaaaccaatgcaggcggggattcaatgaaaataaatggtaaactctataaa
cacggtgtgggtgtaagctcaaccagtgttttatcattttttttaaatggccacgccacc
gagttttcggccatggttggggttgacgataaaggagtaaaagatttaccactaaaattt
tatgtaatcggcgatagaaaaatactgtttgaaagtggtgaaatgaaacttggagatgcc
cccaaacaagtaaaagtaagtcttgtaggcgttaaacgcttaggacttttagttacgatt
gaagaaaatggatttaatcgttcctactccaattgggcagatgctaagtttgttatgaaa
gatgattttattccgcaaacgatgccaaataccgatgaaaaatacattctaacacccaaa
cctgacaaaaagcctaaaattaactcacctaaactttttggagcaagacccaataaccca
ttcctttataccattgctgctacgggcgaacgaccgatgaaatttacagcaaaaaactta
ccacaaggtctttcacttgattcaaaaactgggcaaattacaggaaaagtagctcaaaaa
ggcacttatacaagcactttagtggctaaaaatgcctttggcgaaatcaaaaaggagtta
aaaattatcatcggagatacgattgctcttactcctccaatcggttggaacggttggaat
tcatgggcaagaaacatcgaccgagaaaaagtaatcgcctcggccgatgccatgataaaa
atgggactcaaccaacatggctggacgtacataaatattgatgatgcttggcaagggcag
cgaggtggcgtttttaatgccattcaacccaacgaaaaatttccaaatttcaaagaaatg
gccgattatatccatagtcaagggctgaaacttggagtttattctacgcccatgataaca
agctacgcaggttacattggcggttcttcagattttgttgatggaaaaatcactgattct
atcaaaaacaataaacgagcttttcgctatgttggcaaatatcattttgaagaaaatgat
gccaaacaaatggctacttggggagtagattatttaaaatatgattggagaattgaagtt
ccatcggccgaaagaatgtcggcggctttaaaaaactcaggaagagatattgtttacagt
atttcaaattcagcacccttttcaaatgccaaagattgggcaaagttaagcaatacattt
cgtacgggccccgacatcagagattcttggttgagcctttatctatctgcttttacactc
gacaaatgggctctatacggtggacatggccattggctcgaccccgacatgatgattttg
ggcaatgttacaacaggctctgaacttcatcctacacgccttacgcccgatgagcagtat
agtcatgtaagtctatttagcttactatcagcacctttactgattggctgccccattgag
cagttagacgcttttacactaaaccttttaaccaacgatgaagtaatagaaatcaaccaa
gacccattggggaaacccgctagattagtttcagatgatgatggcatacagatttgggta
aaatcattggaggatggttcgtatgcggttgggctattcaacattgctcattttggaaaa
acacctgaatcatatttccgttggggcgatgaaaaatccacaaattatgtcttgaaactc
aatcaaattggacttaaaggtaatttccgtataagagatgtctggcaacagaaagacttg
ggaaattttaaaaatacattcaaaacaagcatacctcatcatggagtaataatgcttcga
gtatttccaaaaaactag

DBGET integrated database retrieval system