KEGG   Emticicia oligotrophica: Emtol_3354Help
Entry
Emtol_3354        CDS       T02272                                 

Definition
glycoside hydrolase family 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
eol  Emticicia oligotrophica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3665126..3666232)
Genome map
AA seq 368 aa AA seqDB search
MKKVIKYYQLFFYILISPLSFSQNSTGLKDIFANDFLIGTALGAEHILEKNKIANNLILR
EFNAITPENIMKAEVIHPEPNNYSFTLADKFVEYGQKNNLFIAGHTLVWHSQLPKFVHKI
QSADSVRLFMTNHINTVAGRYKGKINSWDVVNEALNEDGTLRKSIFLEKLGEGYIKEAFD
LAAKADPNAELYYNDYNIEQPAKRKGAIELIKKLQASGTKINGVGIQGHWSLKGAPLKDI
EESIIEFSKLGLKVAFTELDITVLPNPWDLKGADVNQNFPGSPFMNPYPKGLPDSVQTEL
AQRYSDIFKIFIKHRDKISRITFWGVNDGHSWLNGWPIRNRTNYPLLFDREFQKKPAYEA
VIKQKSKQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaattaaatattatcaacttttcttctacatactcattagtccactgagt
ttctcgcagaattcaactgggctaaaggatatatttgcaaatgactttttgattggaaca
gctttaggtgctgaacatattttagaaaaaaacaaaatagccaataacttgattttgcgt
gagtttaatgccataactcctgaaaatatcatgaaggcagaggtgattcaccctgagccc
aataattacagttttacattggccgataagtttgtagaatacggacaaaaaaataaccta
tttattgcgggtcatacacttgtatggcatagtcaactacctaaatttgtgcataaaatt
caaagtgcagattctgtacgtttgtttatgaccaaccatatcaatactgttgcgggaaga
tacaaaggcaaaatcaatagttgggatgttgtaaacgaagcattgaatgaagatggcaca
ctaagaaagtctattttcttagaaaaattaggtgaaggatatatcaaagaagcttttgat
ttggcggcaaaggccgacccaaatgccgagctttactataacgattataatatcgaacaa
cctgccaaacgcaaaggtgcgattgaacttatcaaaaaacttcaagccagcggtactaaa
attaatggcgttggaattcaaggacactggagtttaaaaggagcacctttgaaggatata
gaagaatctatcatcgaattttctaagttaggtctaaaagtagcatttacagaacttgat
attacagttttgccaaatccttgggatttaaaaggtgctgatgtgaatcaaaacttcccg
ggaagtccatttatgaacccataccctaaaggtttaccagactctgttcagaccgaatta
gcccaaagatatagcgatatttttaagattttcataaagcacagagataaaattagtcga
atcactttctggggagtcaatgatggacactcatggctgaatggctggccaatcagaaat
cgtactaattatccactacttttcgaccgagaatttcagaaaaagcctgcttatgaagca
gttatcaagcaaaaatctaagcaataa

DBGET integrated database retrieval system