KEGG   Emticicia oligotrophica: Emtol_3507Help
Entry
Emtol_3507        CDS       T02272                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eol  Emticicia oligotrophica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eol00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eol00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3843854..3844462
Genome map
AA seq 202 aa AA seqDB search
MKKKLIIVTVSVLAVGSLMSFRIIKHLFSNKQLAVAKPSNIMAKGSFYDFKLKSLDGKET
IDFAKYKGKKIVVLNTASECGYTPQYADWQKFHEKYGDKIVVLGVPANNFGGQEPGSNKE
IATFCQKNYGVTFQMLEKISVVGNDQHPLYQWLSKKDMNGWNDKAPTWNFCKYVINEKGE
VANFFASGVKPDSPEFKKAVGL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaattaattatcgtaacagtatcagttttagcagttggaagtcttatgagt
ttcagaattatcaaacatttattttcaaataagcaattagcagttgcaaaaccctcgaat
attatggctaaaggctcattttatgatttcaagttgaagtcacttgatggaaaagaaacc
attgattttgctaaatacaaagggaaaaagattgttgtacttaatacagcttctgaatgt
ggatataccccacaatatgctgattggcaaaagtttcacgaaaaatacggtgataaaatt
gtagttttaggagttccagccaataattttggaggacaagaaccaggttcaaacaaggaa
attgctactttttgtcagaaaaactacggtgtaacttttcaaatgcttgaaaaaattagt
gtagttggcaatgaccagcaccccttgtatcagtggttaagcaaaaaagacatgaatggc
tggaatgataaggcaccaacttggaatttctgcaaatatgtaataaatgaaaaaggggag
gttgcaaatttctttgcttctggtgtaaaacccgattcccctgaatttaaaaaagcagta
ggactttaa

DBGET integrated database retrieval system