KEGG   Emticicia oligotrophica: Emtol_3739Help
Entry
Emtol_3739        CDS       T02272                                 

Definition
(RefSeq) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eol  Emticicia oligotrophica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_3739
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_3739
   00640 Propanoate metabolism
    Emtol_3739
   00660 C5-Branched dibasic acid metabolism
    Emtol_3739
Enzymes [BR:eol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Emtol_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4099398..4100618
Genome map
AA seq 406 aa AA seqDB search
MNVHEYQGKEILSRYGVRIQRGIVAETPEQAVAAYQQIAEMTNSKFAVVKSQIHAGGRGK
GNIVGSEQRGVQLAKSADDVQRISTNLLGNVLVTIQTGAEGKKVNKVLVAEDAYYPGESE
PKEYYMGILLDRAKGCNVIMASTEGGMDIEEVAEHHPEKIFKEWVDPRVGLQPFQARKIA
DKLGLTGTANKEMVKFVSSLYQAYVESDSSMFEINPVLKTSDNKILAVDAKVNLDDNALY
RHADLAAMRDKSEEDPLEVEASESDLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGEPA
NFLDVGGGANAKTVEAGFRIILKDPNVKAILINIFGGIVRCDRVANGVVEAYKAIGEIPV
PIIVRLQGTNAAEGAKIIDESGLKVYSAIALKEAAELVEKVLGESK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttcacgagtatcaaggtaaagaaatactaagccgttatggtgtacgtatccaa
cgcggtatcgtagccgaaacgccagagcaggcagtagctgcctatcagcaaatcgccgaa
atgactaactctaagtttgccgttgtgaaatctcaaattcatgcgggtggacgtggaaag
ggtaatatcgtaggctctgagcaaagaggtgtacaattagccaaatctgctgatgatgta
caacgtatctcaacaaatttgcttggaaatgtattagttacaatccaaacaggagccgaa
ggaaagaaagtaaataaggttttagttgctgaagatgcttattatcctggcgaaagtgag
ccaaaagaatattacatgggtattttgcttgatagagcaaaaggatgtaatgtgatcatg
gcttctactgaaggtggtatggatatcgaagaggtagctgagcatcatccagaaaaaata
tttaaagaatgggttgacccacgcgttggtttgcaacctttccaagcacgtaaaattgct
gataaattaggtttgactggtactgccaataaagaaatggttaaattcgtttcttctctg
tatcaagcttatgttgagtctgactcatcaatgtttgaaatcaacccagtattgaaaact
tctgataataaaattttagcagttgatgctaaagtaaatttagatgacaatgctttgtat
cgtcatgctgatttagctgctatgcgtgataaatcagaagaagatccattggaagtagaa
gcttctgaaagcgaccttaactatgtaaaactagacggaaacgttggttgtatggtaaat
ggtgctggtttggctatggctacaatggatatcatcaaactttcgggtggtgagcctgca
aacttccttgatgtaggtggtggtgctaatgctaaaacggttgaagctggtttcagaatt
atcttgaaagacccgaacgtaaaagctattttaatcaacatctttggtggtatcgttcgt
tgcgaccgtgttgctaatggtgtggttgaagcttacaaagcaattggcgaaattccagtg
ccaattatcgttcgtttacaaggtacaaatgcagccgaaggtgcgaaaatcatcgacgag
tctggtttgaaagtttattcggcaattgcattaaaagaagctgctgaattagtagagaaa
gttttgggcgaatctaagtaa

DBGET integrated database retrieval system