KEGG   Emticicia oligotrophica: Emtol_3808Help
Entry
Emtol_3808        CDS       T02272                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eol  Emticicia oligotrophica
Pathway
eol00010  Glycolysis / Gluconeogenesis
eol00620  Pyruvate metabolism
eol00640  Propanoate metabolism
eol00680  Methane metabolism
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_3808
   00620 Pyruvate metabolism
    Emtol_3808
   00640 Propanoate metabolism
    Emtol_3808
  Energy metabolism
   00680 Methane metabolism
    Emtol_3808
Enzymes [BR:eol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Emtol_3808
Lipid biosynthesis proteins [BR:eol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Emtol_3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFK04934
UniProt: I2EZ31
Position
4178924..4180825
Genome map
AA seq 633 aa AA seqDB search
MRISDFNDYEIQYKHSVEDPEGFWAEIAANNFEWRKPWKKVLNWNFTEPKVEWFVGGKLN
ITENCLDRHVKDKPNQPAIIWEPNDPNEEAVILTYRQLFERVCRFSNVLKRNGVKKGDRV
CIYMPMIPELAIAVLACARIGAIHSVVFGGFSASSIADRINDSQCVAVVTTDGAVRGNKS
IPMKDTVDDALIGCPSVKKVIVTTRTRTPVSMIKGRDVWWEEEEKHVTSDCPAEEMDSED
PLFILYTSGSTGKPKGVVQTCGGYMVYSAYTFLNVFQYKPGQIHFCTADIGWITGHSYIV
YGPLANGAITLLFEGIPTYPDAGRFWDIVEKHSVNILYTAPTAIRSLMGFGLEYVEGKDL
SSLKVLGSVGEPINEEAWQWYSKNIGKDKCPVVDTWWQTETGGIMISALAGITPLKPAWA
SLPLPGIQMMLVDEHGNEIEGGDVSGNLCIKFPWPSILRTTWGDHERCRTNYFSAYPNLY
FTGDGAMRDANGFYRITGRVDDVLNVSGHRIGTAEVENAINMHTGVVESAIVGYPHDIKG
QGIYAYVICESMIHDEDLTRRDILATVSRVIGPIAKPDKIQFVSGLPKTRSGKIMRRILR
KIAEGDVSNLGDTTTLLDPNIVDEIKNGAAALK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttctgattttaatgattacgaaatccaatacaagcactcagttgaagaccca
gagggtttttgggcggagattgctgccaataactttgaatggagaaaaccatggaaaaaa
gtattgaattggaattttactgagccaaaagttgaatggtttgtaggtggaaagctcaat
attactgaaaattgcctcgatagacacgtaaaggataagcctaaccaaccagcaattatt
tgggaaccaaacgacccaaatgaagaagcggtaatccttacctaccgtcaattatttgaa
cgtgtttgtcgtttctcaaatgtcttaaaacgaaatggcgtaaagaaaggagatagagtg
tgtatttatatgccaatgattcctgaattagctattgcagttttggcttgtgcacgtatt
ggagcaattcactcggttgtttttggtggtttctctgcatcttcaattgctgaccgaatc
aatgactctcaatgtgtggcagtagttacgactgatggtgccgtacgtggtaacaaatca
attccaatgaaagacaccgtggatgatgctttgattggatgtccttcagttaagaaagta
attgtgacaacgcgtacacgaacgcctgtgagtatgattaaaggccgtgatgtatggtgg
gaagaggaagaaaaacacgtaacaagtgattgcccagcagaagaaatggattcagaagac
ccgctatttattctttatacttcaggttcaactggaaaaccaaaaggagttgttcaaact
tgtggcggatacatggtttattcagcttatactttcttgaatgtatttcagtataaacct
gggcaaattcatttctgtactgctgatattggttggattaccggacattcatacattgtc
tatggaccattagcaaatggtgcaataacacttttgtttgaaggtattcctacgtatcct
gatgcaggacgtttttgggatattgttgagaaacacagcgtaaatattctttacacagca
ccaacagcgattcgttcattaatgggctttggcttagaatacgtagaaggaaaagatttg
agttctttgaaagttttgggttctgttggtgaaccaattaatgaagaagcttggcaatgg
tattcaaaaaatattggaaaagataaatgtccagtagttgatacttggtggcagaccgaa
actggtggaatcatgatttcagcattggctggcattacaccgctcaaaccagcttgggcg
tcattgccactaccgggtattcaaatgatgttggttgatgagcatggaaatgaaattgaa
ggtggtgatgtaagtggaaacctttgtattaaattcccgtggccttcaattttacgtaca
acttggggcgaccatgaacgttgtagaacgaattacttctcggcatacccaaatttatac
ttcaccggtgatggagcgatgcgtgatgccaatggtttttatagaattactggtcgtgta
gatgatgtgttaaatgtatctggacaccgaattggtacggcagaagttgaaaatgctatc
aacatgcacactggagttgttgaaagtgccattgttgggtatcctcatgatattaagggt
caaggaatttatgcttatgtaatctgtgaaagcatgattcatgatgaagaccttactcgt
cgtgatattttagccactgtttcacgtgttattgggccaatcgcaaaaccagataaaatt
caatttgtaagtggtttgccaaaaactcgttcgggtaaaattatgcgtagaattcttcgt
aaaattgcagaaggcgatgtatctaatttaggtgatactaccacacttctcgaccccaac
atcgttgatgaaattaagaatggagctgctgcattgaagtag

DBGET integrated database retrieval system