KEGG   Emticicia oligotrophica: Emtol_3808Help
Entry
Emtol_3808        CDS       T02272                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eol  Emticicia oligotrophica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_3808
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_3808
   00620 Pyruvate metabolism
    Emtol_3808
   00640 Propanoate metabolism
    Emtol_3808
  Energy metabolism
   00680 Methane metabolism
    Emtol_3808
Enzymes [BR:eol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Emtol_3808
Lipid biosynthesis proteins [BR:eol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Emtol_3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4178924..4180825
Genome map
AA seq 633 aa AA seqDB search
MRISDFNDYEIQYKHSVEDPEGFWAEIAANNFEWRKPWKKVLNWNFTEPKVEWFVGGKLN
ITENCLDRHVKDKPNQPAIIWEPNDPNEEAVILTYRQLFERVCRFSNVLKRNGVKKGDRV
CIYMPMIPELAIAVLACARIGAIHSVVFGGFSASSIADRINDSQCVAVVTTDGAVRGNKS
IPMKDTVDDALIGCPSVKKVIVTTRTRTPVSMIKGRDVWWEEEEKHVTSDCPAEEMDSED
PLFILYTSGSTGKPKGVVQTCGGYMVYSAYTFLNVFQYKPGQIHFCTADIGWITGHSYIV
YGPLANGAITLLFEGIPTYPDAGRFWDIVEKHSVNILYTAPTAIRSLMGFGLEYVEGKDL
SSLKVLGSVGEPINEEAWQWYSKNIGKDKCPVVDTWWQTETGGIMISALAGITPLKPAWA
SLPLPGIQMMLVDEHGNEIEGGDVSGNLCIKFPWPSILRTTWGDHERCRTNYFSAYPNLY
FTGDGAMRDANGFYRITGRVDDVLNVSGHRIGTAEVENAINMHTGVVESAIVGYPHDIKG
QGIYAYVICESMIHDEDLTRRDILATVSRVIGPIAKPDKIQFVSGLPKTRSGKIMRRILR
KIAEGDVSNLGDTTTLLDPNIVDEIKNGAAALK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttctgattttaatgattacgaaatccaatacaagcactcagttgaagaccca
gagggtttttgggcggagattgctgccaataactttgaatggagaaaaccatggaaaaaa
gtattgaattggaattttactgagccaaaagttgaatggtttgtaggtggaaagctcaat
attactgaaaattgcctcgatagacacgtaaaggataagcctaaccaaccagcaattatt
tgggaaccaaacgacccaaatgaagaagcggtaatccttacctaccgtcaattatttgaa
cgtgtttgtcgtttctcaaatgtcttaaaacgaaatggcgtaaagaaaggagatagagtg
tgtatttatatgccaatgattcctgaattagctattgcagttttggcttgtgcacgtatt
ggagcaattcactcggttgtttttggtggtttctctgcatcttcaattgctgaccgaatc
aatgactctcaatgtgtggcagtagttacgactgatggtgccgtacgtggtaacaaatca
attccaatgaaagacaccgtggatgatgctttgattggatgtccttcagttaagaaagta
attgtgacaacgcgtacacgaacgcctgtgagtatgattaaaggccgtgatgtatggtgg
gaagaggaagaaaaacacgtaacaagtgattgcccagcagaagaaatggattcagaagac
ccgctatttattctttatacttcaggttcaactggaaaaccaaaaggagttgttcaaact
tgtggcggatacatggtttattcagcttatactttcttgaatgtatttcagtataaacct
gggcaaattcatttctgtactgctgatattggttggattaccggacattcatacattgtc
tatggaccattagcaaatggtgcaataacacttttgtttgaaggtattcctacgtatcct
gatgcaggacgtttttgggatattgttgagaaacacagcgtaaatattctttacacagca
ccaacagcgattcgttcattaatgggctttggcttagaatacgtagaaggaaaagatttg
agttctttgaaagttttgggttctgttggtgaaccaattaatgaagaagcttggcaatgg
tattcaaaaaatattggaaaagataaatgtccagtagttgatacttggtggcagaccgaa
actggtggaatcatgatttcagcattggctggcattacaccgctcaaaccagcttgggcg
tcattgccactaccgggtattcaaatgatgttggttgatgagcatggaaatgaaattgaa
ggtggtgatgtaagtggaaacctttgtattaaattcccgtggccttcaattttacgtaca
acttggggcgaccatgaacgttgtagaacgaattacttctcggcatacccaaatttatac
ttcaccggtgatggagcgatgcgtgatgccaatggtttttatagaattactggtcgtgta
gatgatgtgttaaatgtatctggacaccgaattggtacggcagaagttgaaaatgctatc
aacatgcacactggagttgttgaaagtgccattgttgggtatcctcatgatattaagggt
caaggaatttatgcttatgtaatctgtgaaagcatgattcatgatgaagaccttactcgt
cgtgatattttagccactgtttcacgtgttattgggccaatcgcaaaaccagataaaatt
caatttgtaagtggtttgccaaaaactcgttcgggtaaaattatgcgtagaattcttcgt
aaaattgcagaaggcgatgtatctaatttaggtgatactaccacacttctcgaccccaac
atcgttgatgaaattaagaatggagctgctgcattgaagtag

DBGET integrated database retrieval system