KEGG   Emticicia oligotrophica: Emtol_3819Help
Entry
Emtol_3819        CDS       T02272                                 

Definition
Aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
eol  Emticicia oligotrophica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eol00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eol00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4195237..4196286
Genome map
AA seq 349 aa AA seqDB search
MSIQKSSFGVLPSGQETSLFILKNAAGMEAKISDYGGIVVALTAPDRNGNLNDVVLGCET
LEGYLKGVPYFGAIIGRYGNRIAKGTFQLDGETYSLAINNGVNGLHGGLKGFDKNVWKAE
TIDSVEPVLKLSYLSVDGEEGYPGNLSVEVSYTLTSNALRIDYQATTDKATVLNLTNHSY
FNLSGAEDVLSHEVILHADKFLPVDETVIPTGELRSVVGTPFDFTTSHQIGERINDTSYE
QIVLGSGYDHCYVLTDNSSELRLAAEVYESSTGRIMKVLTTEPGMQFYTANHLKGNIVGK
GGVTYGRRSAFCIETQHFPDSPNKPEFPSTVLRPGEVYTSTTIYQFETK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaaaaatcctcttttggagttttaccaagtggccaagaaacgagcctattt
attttaaaaaatgccgctggtatggaagcgaaaatttcggattatggtggaattgtggtt
gctttaactgctcccgaccgaaacggaaatttaaatgatgtggtattgggctgtgaaaca
cttgaaggttatttaaaaggagttccttattttggagcaatcattggtcgttatggaaat
cgaattgcaaagggcacttttcaattagatggagaaacttattcattagctattaataat
ggtgtgaatggtcttcatggtggattgaaaggatttgataaaaatgtgtggaaggctgaa
accattgattcagtggagcccgttttaaaactttcgtacctttcagtagatggagaagaa
ggatatccgggaaatttatcagtggaggtatcttatactttaaccagcaatgctctacgt
attgattatcaggcaactactgataaagcaactgttttgaatttaaccaatcactcatat
tttaacttaagtggtgctgaagatgtcttatcgcatgaagtaattttacatgctgataaa
ttcttaccagttgatgagaccgttattcctacgggtgaactacgttctgtggtgggaact
ccttttgattttactacaagtcatcaaattggtgagcgtattaatgatacttcctacgag
caaattgtgttaggtagcggatatgaccattgctatgttttaactgataatagttcagaa
ttgaggttagctgctgaagtttatgaatcttctaccggtaggataatgaaagtattaaca
accgaaccaggaatgcaattctataccgccaatcatttaaaaggaaatatagttggtaaa
ggtggagtgacctacggacgacgttcggcgttttgtatcgaaacccaacattttccagat
tcgccaaataaacctgaatttccgagcactgtactaagacctggtgaggtttacacatca
acaacaatttatcaatttgagactaagtaa

DBGET integrated database retrieval system