KEGG   Emticicia oligotrophica: Emtol_3888Help
Entry
Emtol_3888        CDS       T02272                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eol  Emticicia oligotrophica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Emtol_3888
  Amino acid metabolism
   00340 Histidine metabolism
    Emtol_3888
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Emtol_3888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4279697..4280968
Genome map
AA seq 423 aa AA seqDB search
MNIISFPQRSEWKNLLARPVKEMAEIEQKVLPILQKVKHEGDSALKEFALKFDKVELNNF
QVSQQEIDAAEGLLSFELKEAIGQAYNNIYTFHQSQKQSPEVIETMAGVKCWRKSVGIQK
VGFYIPGGTAPLFSTVLMLGVPAQIAGCEERILCSPSNHPAIYYAAKLVGITKVYRIGGA
QAIAAMAYGTESIPQVYKIFGPGNQYVTAAKQLLSKEGVAIDMPAGPSEVAVMADDFAIP
SFVASDLLSQAEHGADSQVLLVSTSKKFVSAVNLAVSGQLNRLPRKDLASKAIENSKIIL
LDNEQDCIDLINEYAPEHLILAVENYNEVGEKIINAGSIFLGNYTPESCGDYASGTNHTL
PTNGYARAYSGVSVDSFVKKITFQEISKEGILNIGRTVELMAEAESLEAHKRAVSLRMES
LTN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatttcgtttccacaacgctcagaatggaagaacttgcttgcaagaccagtg
aaagaaatggccgaaattgagcaaaaggtacttcctatcttacaaaaagtaaagcatgaa
ggcgattcggcattaaaagagtttgctttaaaatttgataaggttgaactaaataacttt
caagtttcacaacaggaaattgatgctgctgaggggcttctttctttcgaactgaaggaa
gcaattggacaagcatacaacaatatttatacatttcatcaatcacaaaaacagtcaccc
gaggttatcgaaacaatggcaggggtgaaatgctggagaaaaagtgtaggtattcaaaaa
gttggattttatattccaggtggaacagctccattgttctctaccgttttaatgttaggt
gttcctgcacaaattgctggttgtgaagaaagaatactttgttctccaagcaatcatcct
gcaatttattatgcagctaaattagttggtataacaaaggtgtatcgaattggtggggca
caagctattgcagcaatggcttatggcactgaatctattccacaagtatataagattttt
ggccctggaaaccaatatgttactgctgctaaacagctattaagtaaagaaggtgtagcg
atagatatgcctgctggaccttcagaagtagcagtgatggcagatgattttgcaattcct
tctttcgtagcatctgatttactttcacaggccgaacatggggctgatagtcaggtatta
ttggtttctacaagtaagaaatttgtttcagcagtaaatcttgcagtttcaggacaatta
aatagacttccaagaaaagatttagcttctaaagctattgaaaattctaagattattttg
ttggataacgagcaagattgcattgatttaatcaatgaatatgctcctgagcacctaatt
ttagccgtagaaaactacaatgaggtaggagaaaaaattatcaatgcaggttctatcttt
ttaggaaattacacacctgaatcatgtggagattatgcatcgggtacaaatcatacacta
ccaaccaacggttatgctcgtgcttatagtggtgtttcggttgatagttttgtaaagaaa
attactttccaagaaatctctaaagaaggtattcttaatatcggccgaacagttgaacta
atggccgaagcagaatctttagaagctcacaaacgagcggtgtctttgcgtatggagagt
ttaacaaattaa

DBGET integrated database retrieval system