KEGG   Emticicia oligotrophica: Emtol_3890Help
Entry
Emtol_3890        CDS       T02272                                 

Definition
Aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
eol  Emticicia oligotrophica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_3890
   00052 Galactose metabolism
    Emtol_3890
Enzymes [BR:eol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Emtol_3890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4281836..4282996)
Genome map
AA seq 386 aa AA seqDB search
MKLKALSLLLCSALLFQNCTSKKTETTQDSTTSTIKSIEKVDFGNLPSGEKAELYTLKNA
NGMVVKITNYGGIITNWLAPDKNGKYVDIALGSDSLKDYLDASPYFGALVGRYGNRIAKG
KFTLDGKTYTLAQNNGVNALHGGKKGFDKVLWNATPIDGEEPQLKLTYTSADGEEGYPGK
LDVEVIYTLQKDNSLKIDYQAKTDKATVVNLTNHAYFNLTGDFTKEVLDHEVILNADKFL
PVDETLIPTGELKAVAGTPFDFTKSFKIGARINDPKDVQIKYGKGYDHCWVFTDTSNKLK
NVASVYEPNSGRVLEVFTTEPAIQFYTGNFLDGKAKGKGVSYKFRTGFCLETEHYPDSPN
QAKFPTTVLKPNETYQTTTIYKFSTK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaggccctaagtttgctgctttgcagtgcacttttatttcaaaattgtacc
tcaaaaaaaacagaaactacacaagactccacaacttcaacaataaaaagtattgaaaaa
gttgattttgggaatttaccttctggtgaaaaagcagagctttatactttaaaaaacgcg
aatggtatggttgtaaaaataaccaactatggtggaattattacaaactggcttgctcct
gataaaaatggcaaatatgtagatatcgctctcggctctgattctttgaaagattattta
gatgcttctccttactttggtgcattagttggccgatatggtaatcgaattgctaaaggc
aaatttacacttgatggcaaaacctatacacttgctcaaaataatggtgtaaatgctctc
cacggcggtaaaaaaggctttgataaagtattatggaacgctactcccattgacggcgaa
gaaccacaattgaaattaacttatacttctgcagatggagaggaaggctatcctggtaaa
ttagatgtagaagtaatttatacgcttcaaaaagataattctctgaaaattgattatcaa
gcaaaaaccgataaagctacggtggttaatcttactaatcatgcttattttaatttaact
ggagatttcactaaagaagtacttgaccacgaagtaattctgaatgctgataaattctta
ccagttgatgaaacacttattcctacaggtgagttaaaagccgtagccggtacacctttt
gattttaccaaatcattcaaaattggggcaagaataaatgaccctaaagatgttcaaatt
aaatatggaaaagggtatgaccattgttgggtatttacggatacaagcaataaattaaaa
aatgttgcaagtgtttatgaacctaattcaggtcgagttttagaagttttcactaccgaa
ccagctattcaattctacactgggaatttcttagatggaaaagcaaaagggaaaggtgtt
agttataaattccgtacaggattttgtttagaaactgagcattacccagattcaccaaat
caagcgaagtttccaactaccgttttgaaaccaaacgaaacctatcaaacgacaaccatt
tataagttttcaactaaataa

DBGET integrated database retrieval system