KEGG   Emticicia oligotrophica: Emtol_4084Help
Entry
Emtol_4084        CDS       T02272                                 

Definition
catalytic domain-containing protein of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eol  Emticicia oligotrophica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_4084
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_4084
  Amino acid metabolism
   00310 Lysine degradation
    Emtol_4084
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Emtol_4084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4522243..4523550
Genome map
AA seq 435 aa AA seqDB search
MALIEMIMPKMGESIFECTVLNWLKNVGDKVEADDMILEVATDKIDTEIGASHSGIIKEF
LVQKGEIAVIGKPICIIEVEGENSTDKKPIVTETNSQLTEPEKIVEMPGGVPVSLLTSQP
NIEKASNGTNNRFYSPLVLNIAKEEGISMEELNKVVGTGLEGRVTKDDILAYVKQAADKS
AQPAYGNQSVPEQSITVSGSDQIIEMDRMRKMIAERMVESKRISAHVTSFVETDMTNSSL
WREKIKGKFKHDTGENITFTPLLIEAVVKAIKDFPMINIQIDGDKIIKKARINIGMAVAL
PNGNLIVPVIHDADSYSLIGLTKKINDLTFRARNNKLKADDLADGTLTVSNIGSFGNIAG
TPIIMQPQVSILAFGVIQKKVSVIETPHGDTIGIRQKMIISHSYDHRVVDGSLGGQFVKR
VSDYLENFDLERKLF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctttaattgaaatgataatgcccaaaatgggtgagagtatttttgagtgtacggtt
ttgaactggctaaaaaatgttggagataaagtcgaagcggatgatatgattttggaagta
gcaactgataaaatcgacaccgaaatcggtgcttcacattcgggaattatcaaagaattt
ttagtacagaaaggcgaaattgcagtaattggaaagccgatttgtatcatagaagttgaa
ggtgaaaattctactgataagaaaccaattgttactgaaacaaatagtcagttaaccgag
cctgaaaaaatagttgaaatgccgggtggtgttccagtgagtttacttacttctcaaccc
aatattgaaaaagcttctaacggtacaaataatagattttattctccattggtattgaat
attgctaaagaagaaggcatttcaatggaagaattgaataaagtggtaggtacaggcttg
gaaggacgagtgacgaaagatgatattttagcctatgtaaagcaagcggctgataaaagt
gcccagccagcttatggcaatcaaagcgtgcctgaacaatcaattacagtttctggaagt
gaccaaattattgagatggacagaatgcgtaaaatgattgccgaacgcatggtcgaatcg
aaacgtatttcagcacatgttacgtcatttgttgagactgatatgactaattcttcactt
tggcgtgaaaagattaaaggtaaattcaagcatgataccggagaaaatatcacttttacg
ccattactcattgaagctgttgtgaaggccatcaaagattttccaatgataaatattcag
attgatggtgataaaatcatcaaaaaagctagaatcaatattggaatggcagtggcatta
ccaaatggtaatttaattgttcctgtcattcacgatgcggattcttacagtttgattggt
ttaacaaagaaaattaatgaccttactttccgagctagaaataataaattaaaagctgat
gatttagctgacggaaccctgactgtatcgaatattggttctttcggaaatattgcagga
acgccgattattatgcaaccacaggtttcaatattggcttttggtgtaattcaaaagaaa
gtttctgtaattgagacacctcatggggatactatcggtattcgtcagaaaatgattatt
tctcattcatacgaccatagagttgtggatggctcgcttggcggacagtttgtgaagcgt
gtttctgattatctagaaaattttgacttagaaagaaaactattctga

DBGET integrated database retrieval system