KEGG   Emticicia oligotrophica: Emtol_4084Help
Entry
Emtol_4084        CDS       T02272                                 

Definition
catalytic domain-containing protein of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eol  Emticicia oligotrophica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Emtol_4084
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Emtol_4084
  Amino acid metabolism
   00310 Lysine degradation
    Emtol_4084
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Emtol_4084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4522243..4523550
Genome map
AA seq 435 aa AA seqDB search
MALIEMIMPKMGESIFECTVLNWLKNVGDKVEADDMILEVATDKIDTEIGASHSGIIKEF
LVQKGEIAVIGKPICIIEVEGENSTDKKPIVTETNSQLTEPEKIVEMPGGVPVSLLTSQP
NIEKASNGTNNRFYSPLVLNIAKEEGISMEELNKVVGTGLEGRVTKDDILAYVKQAADKS
AQPAYGNQSVPEQSITVSGSDQIIEMDRMRKMIAERMVESKRISAHVTSFVETDMTNSSL
WREKIKGKFKHDTGENITFTPLLIEAVVKAIKDFPMINIQIDGDKIIKKARINIGMAVAL
PNGNLIVPVIHDADSYSLIGLTKKINDLTFRARNNKLKADDLADGTLTVSNIGSFGNIAG
TPIIMQPQVSILAFGVIQKKVSVIETPHGDTIGIRQKMIISHSYDHRVVDGSLGGQFVKR
VSDYLENFDLERKLF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctttaattgaaatgataatgcccaaaatgggtgagagtatttttgagtgtacggtt
ttgaactggctaaaaaatgttggagataaagtcgaagcggatgatatgattttggaagta
gcaactgataaaatcgacaccgaaatcggtgcttcacattcgggaattatcaaagaattt
ttagtacagaaaggcgaaattgcagtaattggaaagccgatttgtatcatagaagttgaa
ggtgaaaattctactgataagaaaccaattgttactgaaacaaatagtcagttaaccgag
cctgaaaaaatagttgaaatgccgggtggtgttccagtgagtttacttacttctcaaccc
aatattgaaaaagcttctaacggtacaaataatagattttattctccattggtattgaat
attgctaaagaagaaggcatttcaatggaagaattgaataaagtggtaggtacaggcttg
gaaggacgagtgacgaaagatgatattttagcctatgtaaagcaagcggctgataaaagt
gcccagccagcttatggcaatcaaagcgtgcctgaacaatcaattacagtttctggaagt
gaccaaattattgagatggacagaatgcgtaaaatgattgccgaacgcatggtcgaatcg
aaacgtatttcagcacatgttacgtcatttgttgagactgatatgactaattcttcactt
tggcgtgaaaagattaaaggtaaattcaagcatgataccggagaaaatatcacttttacg
ccattactcattgaagctgttgtgaaggccatcaaagattttccaatgataaatattcag
attgatggtgataaaatcatcaaaaaagctagaatcaatattggaatggcagtggcatta
ccaaatggtaatttaattgttcctgtcattcacgatgcggattcttacagtttgattggt
ttaacaaagaaaattaatgaccttactttccgagctagaaataataaattaaaagctgat
gatttagctgacggaaccctgactgtatcgaatattggttctttcggaaatattgcagga
acgccgattattatgcaaccacaggtttcaatattggcttttggtgtaattcaaaagaaa
gtttctgtaattgagacacctcatggggatactatcggtattcgtcagaaaatgattatt
tctcattcatacgaccatagagttgtggatggctcgcttggcggacagtttgtgaagcgt
gtttctgattatctagaaaattttgacttagaaagaaaactattctga

DBGET integrated database retrieval system