KEGG   Emticicia oligotrophica: Emtol_4125Help
Entry
Emtol_4125        CDS       T02272                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eol  Emticicia oligotrophica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eol00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4574470..4575150
Genome map
AA seq 226 aa AA seqDB search
MSNIQFKENNLVNELLFEDNDHPFTKLETPLREDAFDLNDDEKIEIIEKHFKEIMLTLGL
DLQDESLRGTPRRVAKMYVKELFSGLNPENEPAMTLFTNEYNYSEMLVEKNIQFYSCCEH
HFVPIVGKVHIAYISGGKVIGLSKLHRIVNHFARRPQVQERMTIQIGNALKRALMTDDVA
VYVDADHQCVSSRGVKDQTSSTITTFYDGAFRNEEKRSEFLKVLSI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatatccaatttaaagaaaataacttagtgaacgaattattattcgaagacaac
gaccatccgtttacgaaattagaaactcctcttcgtgaagatgcttttgatttgaacgat
gatgaaaaaattgagattattgaaaagcatttcaaggaaattatgcttacacttggtctt
gatttacaagatgagagtctaagaggtacaccacgccgtgttgctaaaatgtatgtaaaa
gaattgttttctggcctaaatcccgaaaatgaaccagccatgacacttttcactaatgaa
tataattatagtgaaatgttggttgaaaagaatattcagttctattcatgttgcgagcac
cactttgtaccaattgtgggtaaagtacatattgcttatatatcaggtggtaaagtaatt
ggcttatccaaacttcatcgaattgtcaatcattttgctcgaagaccccaagtacaagaa
cgaatgacaatacaaattggaaatgctctaaaaagagcacttatgactgatgatgtagct
gtttacgttgatgccgaccaccaatgtgtatcttcaagaggagtaaaagaccaaacaagt
tctacaattacaaccttttatgatggtgcttttagaaatgaagaaaaacgaagcgaattt
ttaaaggttctttcgatataa

DBGET integrated database retrieval system