KEGG   Emticicia oligotrophica: Emtol_4165Help
Entry
Emtol_4165        CDS       T02272                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eol  Emticicia oligotrophica
Pathway
eol00010  Glycolysis / Gluconeogenesis
eol00020  Citrate cycle (TCA cycle)
eol00620  Pyruvate metabolism
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
Module
eol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_4165
   00020 Citrate cycle (TCA cycle)
    Emtol_4165
   00620 Pyruvate metabolism
    Emtol_4165
Enzymes [BR:eol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Emtol_4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: AFK05289
UniProt: I2F036
Position
complement(4622754..4624367)
Genome map
AA seq 537 aa AA seqDB search
MAEVIRMPKMSDTMTEGVIAAWNKKVGDVVKSGDILAEVETDKATMDMESYYDGTLLYIG
VEKGQAVPVDAIIAVIGKAGEDFQSLLNGSPAPSAPVEATPVAQETAPVAAVPAVDTSNI
KAKVVTMPLLSDTMTEGVIHAWLKKVGDKVKSGDILAEIETDKATMELEAYEDGTLLYIG
VEAGKAAKVNGVIAVIGEEGANYQALLGGAPSAPAPAAQEVKVETPKSTAPAPSTPSAAP
VHASNSNGRILASPLAKKLAEEKGIKLAEVSGSGEGGRIVKSDVDNFTPKAQESAKTASS
TPAPVAAGIESYEEISLTQMRKAIARSLAESQSSAVDFQLTMEICMDKAIQAREVMNQAS
PVKISFNDMVLKACGVALKKHPNINSSWRDDHIRRNQHVHIGMAVAIAEGLVVPVIRFAD
TLSLSTLAATTKDLGGKAKNGKLQPKDWEGNTFTVSNLGMFGIEQFTSIINNPKNESCIL
SVGGIKETVAVKNGQFYATNIMKVTLTCDHRVVDGATGAAFLVTLKELLEEPYKLLV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatcagaatgcccaagatgagcgacaccatgacagaaggtgtaattgcg
gcatggaacaaaaaagttggtgatgttgtaaaatcaggagatattttagcagaggtagaa
actgataaggctaccatggatatggagtcttattatgatggtacgcttttatatattggt
gttgagaaaggacaagctgtaccagtagatgctatcattgctgtaattggtaaagctggc
gaagatttccaaagtttattaaatggaagtccagcaccgagtgctcctgttgaagctaca
cccgtagctcaagaaactgcacctgtagcagcagtaccagctgtggatacttcaaatatc
aaagcaaaggtagttacgatgccacttttgagtgataccatgaccgaaggtgtaattcat
gcatggttgaagaaagtaggtgataaagttaagtcgggtgatattctagctgaaatcgag
acagacaaagctacaatggaacttgaagcttatgaagatggaactttattgtatataggt
gtagaagcgggtaaagctgcgaaagtaaatggagtaattgcagttattggtgaggaaggt
gcgaattatcaagcccttcttggtggtgctccatcggctccagctccagcagctcaagaa
gttaaggttgaaactccaaaaagtacagctccagccccttcaactccaagtgcagcacca
gttcatgcatcaaacagcaatggaagaatccttgcatctccattagcaaaaaaattagcc
gaagaaaaaggcatcaaattagcagaagtgagcggttctggtgaaggtggccgtatcgtt
aaatcagatgttgataactttactccaaaagcacaagaatctgcaaaaacagcatcttct
actccagctcctgtagctgctggcattgaaagctacgaagaaattagcttaactcaaatg
agaaaagccattgcacgtagtttagctgaatcacaatctagtgcagttgatttccaatta
accatggaaatttgcatggataaagctatccaagctagagaagtaatgaatcaggcttca
ccagttaaaatctcattcaacgatatggtattaaaagcttgcggtgttgcactgaaaaag
catccaaatatcaactcttcttggagagacgaccatataagacgtaaccaacacgtgcac
attggaatggcagtggccattgctgaaggtttggtagtaccagtaattcgttttgccgat
acactttcactttcaacattagctgctactactaaagatttaggtggaaaagccaaaaat
ggcaaattacagccaaaagattgggaaggaaatacatttactgtaagtaatttagggatg
tttggaattgaacaatttacttcaattatcaataatcctaaaaatgaatcatgtattctt
tctgttggtggaatcaaagaaaccgttgctgttaaaaatggtcagttctatgcaactaat
atcatgaaagtaacgcttacttgtgaccatcgcgtggttgatggagcaactggggcagct
ttcttagttactttaaaagaattacttgaagaaccatataaattattagtataa

DBGET integrated database retrieval system