KEGG   Emticicia oligotrophica: Emtol_4255Help
Entry
Emtol_4255        CDS       T02272                                 

Definition
aminotransferase class I and II
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eol  Emticicia oligotrophica
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Emtol_4255
   01230 Biosynthesis of amino acids
    Emtol_4255
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Emtol_4255
   00290 Valine, leucine and isoleucine biosynthesis
    Emtol_4255
Enzymes [BR:eol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Emtol_4255
    2.6.1.66  valine---pyruvate transaminase
     Emtol_4255
Amino acid related enzymes [BR:eol01007]
 Aminotransferase (transaminase)
  Class I
   Emtol_4255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4727365..4728606
Genome map
AA seq 413 aa AA seqDB search
MQNTINKSNRLNNLSYAIRGPVFEKAQQLEAMGQKIINLNIGNPAPFGFDVPDEIVHDMI
MNIRNAQGYVHHLGIFAARKAIMHYTQQIGIQGVTIDDIFIGNGVSELIVMTMQALLNDG
DEILIPSPDYPLWTTSVALSGGKPVHYICDEESDWNPDLDDIRRKITRKTKGIVVINPNN
PTGAVYDKDILEGIIKIAAEHNLIVFADEIYDKILFDGAKHIPMGSLSEDVFVMTYGGLS
KNYRATGFRGGWVILSGATHRAKSFVEGFTLLASLRLCANVPAQYAIQTALGGYQSINDL
VAPTGRLCKQRDLIHYKMTDIPGITCVKPKGALYLFPKIDLKKFSFKDDEQFVYDLLCEQ
KVLVVSGTGFNYLKPDHFRIVFLASSEELETASGRIRNFLDHSRTRIDELELV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatactatcaataaaagcaatcgtctcaataacttgagctatgccattcgtgga
ccagttttcgaaaaagctcaacaattagaggcgatgggacaaaaaatcatcaatttgaat
attggcaaccctgcccctttcggatttgatgtgcctgacgagattgttcatgatatgatt
atgaatatcagaaatgcacaaggatatgtacatcatttgggaatttttgctgctaggaag
gcaatcatgcattatacacaacaaattggtattcaaggagttacgattgatgacatattt
attggcaacggtgtaagcgaattaatcgttatgaccatgcaagccttattgaatgatgga
gatgaaattttgattccttcgccagattatccattatggactacctctgttgctctttct
gggggaaaacctgtacactacatttgtgatgaggagtcagactggaaccctgatttagat
gatattagaagaaaaattacacgtaagaccaaaggtattgttgtaattaatccgaataat
ccaactggagccgtttacgataaagatattttagaaggaattattaaaatcgccgcagaa
cacaatctaattgtatttgctgacgaaatttatgataaaattctttttgatggtgccaaa
catattcctatgggctcattaagtgaagatgtttttgttatgacttatggcgggctatca
aaaaactatcgtgcaactgggtttcgtggaggttgggttatattaagcggtgctacacac
cgtgctaaatcatttgtggaaggttttacacttttagctagcctccgactatgtgccaat
gtgcctgctcaatatgctattcaaactgctttaggtgggtatcaaagtatcaatgactta
gttgcacctactggcagactttgtaaacaaagagacttaatacactataaaatgaccgat
attccgggaattacgtgtgtaaagcccaaaggtgccttatatctttttccaaagattgac
ctcaaaaagttttcattcaaagatgatgaacaattcgtttacgaccttctttgcgaacaa
aaagttttagttgtttcaggaacaggattcaactatttaaaaccagaccatttccgaatt
gttttcttagcgtcatctgaagaacttgagaccgcatcaggaagaataaggaatttttta
gaccattctcgtacgaggatagatgagctagaactggtgtaa

DBGET integrated database retrieval system