KEGG   Exaiptasia pallida: 110231563Help
Entry
110231563         CDS       T05080                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
epa  Exaiptasia pallida
Brite
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110231563
Peptidases [BR:epa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   110231563
Exosome [BR:epa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110231563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 322 aa AA seqDB search
MENRAEQQTSLLWRIVKKFIQLSIMIPVTGYILVVIIMYSSPWARNQVIYLNYARNPFTD
LTBPSIHGVENAINLYIDGPAGRLGAWYIQAKSKKFYGAINLDDGNPVMVYFHGNAYTRA
EKHRVALYKLLSSMSYHVVTLDYRGFADSDGVPSEQGLIDDGLATYEWVKARSGNSTVYI
WGHSLGTAVGTGVAKVLCDRGAPPSGVILEAPFNNVYDAGQEHKIAKPFKFLPYFQEIVM
DEVKELFRTDKRIVDVYCPILILHDRTDDIILFKYAEKLYQHARSFRPKDAAFIKLVEFH
GHGHNWICESKVLPDIIRAFVK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagggcggaacaacagacttcattgctatggaggattgtgaagaaattcatt
caattatcgataatgataccagtaacaggatacatactggttgtaattattatgtatagt
tcaccttgggctagaaatcaagttatctatcttaattatgctaggaatcctttcacagat
ttgactracccatctatacacggtgttgaaaatgctattaatttatacattgatgggcct
gctggaagactgggggcctggtacatacaagcaaagagtaagaaattttatggtgcaatc
aatcttgatgatgggaaccctgtgatggtatatttccatggtaatgcgtataccagagca
gaaaaacacagagttgctctatacaagctcctytcttcaatgtcttatcatgtagtgacc
ttagactacagaggttttgcagattcagatggagttccttcagagcagggtttgattgat
gacggtcttgctacttatgaatgggtcaaggcgaggtctggaaactcaactgtgtatatw
tggggccattctcttggaacagctgtaggcactggagtagcaaaagtactgtgtgataga
ggtgctccaccttctggagtgatcttggaggctccttttaataacgtgtatgatgctgga
caagaacacaagatagccaagcctttcaagttcctgccgtatttccaagaaatcgtcatg
gatgaagtcaaggagttgttcagaactgataaaaggatagttgatgtgtattgccccatt
ttgattctacacgatcgtacagatgacatcatcctcttcaaatacgctgaaaagctatat
cagcatgccaggagttttcgtcccaaggatgcagcgtttatcaaactggtcgagttccat
ggtcatggacacaactggatctgcgagtccaaagttctacccgacattatacgtgctttt
gtgaaatga

DBGET integrated database retrieval system