KEGG   Exaiptasia pallida: 110242478Help
Entry
110242478         CDS       T05080                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
epa  Exaiptasia pallida
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:epa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    110242478
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110242478
Peptidases [BR:epa01002]
 Serine Peptidases
  Family S33
   110242478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 295 aa AA seqDB search
MEINDIKTEIQINTTEGSFKNKDGKVIFTRQWSQKDKAPRALIMICHGFGEHSGRYADFL
APALVKEGFLVTTLDHVGHGKSEGERAQVDSLDTFVGDVFHNIDQVTAKYQSLPMFIFGH
SMGGAITILCALQRPKFFQGVLLSAPAILVDPSKDNKCMRCLGNVAAFIYPSLEVIPPID
PGETCRNPDKVEEYRTDPLVFHGGIKAGLGMALANGMDTINAKMKDIDWPFLVMHGDADS
LALVEGSIKLEKMAKSQDKTIKIYEGYYHEILNEPREYSSIVLNDIIQWLRERLS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaatgacatcaaaactgaaatacaaataaacacaacagagggctcgttcaaa
aacaaagatggaaaagttattttcacaagacaatggtctcaaaaggataaagcgccgagg
gctttgataatgatatgtcatggatttggagagcactctgggagatatgctgattttttg
gcacctgcacttgtaaaggaaggttttcttgttacaactctagaccatgttggtcatggt
aagagtgaaggagaacgagcacaggttgacagtcttgacacatttgtgggggatgttttc
cataatattgaccaagttactgcaaaataccaatcattacctatgttcatatttggtcat
tctatgggaggagctatcaccatactgtgtgcattacagagaccaaagttctttcaaggt
gtattactaagtgctccagcaatcctggtggatcccagtaaagacaacaaatgtatgcga
tgtcttgggaatgtggctgcatttatttatccttctcttgaagtaattccaccaatagat
ccaggtgaaacttgccgcaaccctgacaaggtagaagaatacagaactgatccattagtg
ttccatggtggcattaaagctggacttggcatggctctagcgaatggaatggacactatc
aatgctaagatgaaagacattgactggccattcctggtaatgcatggtgacgctgattca
ctggcactggttgaaggttcaatcaagttggagaaaatggccaaaagccaagacaaaacc
atcaagatttatgaaggttactaccatgagatattgaatgaaccaagagaatactccagt
atcgtactcaatgacatcatacaatggctgagagagagattgtcttag

DBGET integrated database retrieval system