KEGG   Exaiptasia pallida: 110250920Help
Entry
110250920         CDS       T05080                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
epa  Exaiptasia pallida
Brite
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110250920
Peptidases [BR:epa01002]
 Serine Peptidases
  Family S33
   110250920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 326 aa AA seqDB search
MEFSQILVFLALMTACLTLLVWIFCLLGYFLWPSLLVEIFQRWNMYRAGFTPKTIDVGDF
QFCYMERGLPSDTNQTIVLIHGFAASKDAWCYMSHALPKTEHIIALDLPGHGKSTRKHDG
DHTIPTQVAKLHQFVHAIGLHQRKFHLAGISMGGHIVGVYASRHPSNLSSVIMMCPAGID
APHLSEFLEDVLHKGERNYLIPETTEDFLTMWKKVVHRYIPLPYFAARLFTEVRKPFNEF
YKKVLLDITHPDHRFLLQNVLEDITVPALVLWGENDKIIHVSSVNVMKEKLKNSQVHILD
RCGHALSLERPWKTAKLMMEFISSCN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaattttctcaaattctggtgtttttggctttgatgactgcatgcttgacacttctg
gtctggatattttgcctgcttggttattttttgtggccatcacttctagtggagattttc
caaagatggaacatgtacagagcaggattcacaccaaagacaattgatgttggtgatttc
cagttttgctatatggaaagaggacttccaagtgatacaaatcaaacaattgtacttatt
catggatttgctgcaagtaaagatgcttggtgctacatgtcacatgcccttcccaaaaca
gagcacatcattgcactggaccttcctggacatggaaaatcaaccaggaaacatgatgga
gaccataccataccaacacaagttgctaaattgcatcagtttgtacatgctataggcctt
catcagagaaagtttcacctggctgggatctcaatgggtggccatattgtaggagtttat
gcttcaaggcacccaagcaacctgtcatctgtgataatgatgtgtccggcaggcattgat
gcccctcatctcagtgaattcttagaagatgttttgcacaaaggggaaagaaactacttg
attcctgaaacgactgaagactttcttaccatgtggaaaaaagtagtacatcggtacatc
cctttgccttactttgctgcaaggttattcactgaagtcagaaaacccttcaatgaattt
tataaaaaagttttactagacatcacacaccctgatcatcgtttcctcttacaaaatgtc
ttggaggacattacagtaccagctctggtcctatggggagagaatgacaagatcatccat
gtttcatccgtcaatgtgatgaaagaaaagttaaagaattctcaagtgcacatattggat
aggtgtggccatgccttatcgttggaaagaccgtggaagaccgccaaactaatgatggaa
tttatatcttcatgtaattga

DBGET integrated database retrieval system