KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00112Help
Entry
EPYR_00112        CDS       T02121                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_00112 (pfkA)
   01230 Biosynthesis of amino acids
    EPYR_00112 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_00112 (pfkA)
   00030 Pentose phosphate pathway
    EPYR_00112 (pfkA)
   00051 Fructose and mannose metabolism
    EPYR_00112 (pfkA)
   00052 Galactose metabolism
    EPYR_00112 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EPYR_00112 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EPYR_00112 (pfkA)
Enzymes [BR:epr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EPYR_00112 (pfkA)
Protein phosphatases and associated proteins [BR:epr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EPYR_00112 (pfkA)
Messenger RNA biogenesis [BR:epr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EPYR_00112 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125452..126414
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRHEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAITEHICDIDELAKYIEQETK
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgccccaggcatgaatgcggcg
atccgtggtgttgtgcgcgccgcccttagcgaaggtcttgaagtttgcggcatttatgac
ggctatctgggcttgtatgaggaccgcatgatcaatctcgaccgctacagcgtatcggat
atgattaaccgtggcggtaccttcctgggttccgcacgcttcccggagtttcgccatgag
gatgtgcgcagcgtcgccatcgaaaacatgaagaaacgcggcatagacgcactggtggtg
atcggcggtgatggttcgtatatgggggccaagcgcctgaccgaaatgggcttcccatgt
attggtctgccgggcaccattgataacgacgtggccggcactgattacaccattggctat
ttcaccgcgctggaaaccgtggtggaggcgatcgaccgcttgcgtgatacttcgtcctcg
caccagcgtatttcaatcgttgaggtgatggggcgttactgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtactgccggaaattccttatactcgtgag
gagctggtgaatgagatcaaagccgggattgccaaaggtaaaaagcacgcgattgtagcg
atcacggaacatatctgcgatatcgacgagctggcgaaatatatcgaacaggaaaccaaa
cgcgaaacgcgctcaacggtgctgggtcatattcagcgcggcggtgctccggttgcttat
gaccgtattctcgcgtcacgcatgggtgcctactcgatagaactgctgttacaaggttac
ggtgggcgctgtgtcggcattcagaatgagaagatggtgcatcacgatattatcgatgcg
attgaaaacatgaaacgtccgtttaaaggtgactggctggataccgccaagaaactctac
tag

DBGET integrated database retrieval system