KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00130Help
Entry
EPYR_00130        CDS       T02121                                 

Gene name
tpiA
Definition
(RefSeq) protein tpiA (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_00130 (tpiA)
   01230 Biosynthesis of amino acids
    EPYR_00130 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_00130 (tpiA)
   00051 Fructose and mannose metabolism
    EPYR_00130 (tpiA)
   00562 Inositol phosphate metabolism
    EPYR_00130 (tpiA)
Enzymes [BR:epr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EPYR_00130 (tpiA)
Exosome [BR:epr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EPYR_00130 (tpiA)
  Exosomal proteins of bladder cancer cells
   EPYR_00130 (tpiA)
  Exosomal proteins of melanoma cells
   EPYR_00130 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(144189..144956)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNKHMVNELIAGLRTELSGVDGCGVAIAPPVMYLDQAKQAISGSPVA
LGAQNVDVNLSGAFTGEVSAEMLKDIGARYIIIGHSERRTWHAESDELIAKKFAVLKATG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNSQGADAFTGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAQKDATVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaaactcaatggcaacaagcacatggtcaac
gaactgatcgccggtctgcgtaccgagctgagcggcgttgatggttgtggggtggcgatt
gctccccctgtcatgtatctggatcaggcgaagcaggccatttccggcagccctgtcgcc
ctgggtgcgcagaacgttgacgttaacctgtctggcgctttcactggcgaagtttctgcc
gagatgctgaaagacatcggcgcacggtacatcattattggccactccgagcgccgtacc
tggcacgcagaaagcgatgaactgattgcgaaaaaatttgccgtgctgaaggcgacgggt
ctgatcccggtgctgtgcattggtgaaaccgaagcggaaaatgaagcgggtaaaaccgaa
gaagtctgcgcacgtcagatcgatgcggtactgaattcgcagggcgctgatgctttcact
ggtgtggtgatcgcttatgaacccgtatgggcaatcggcacgggcaaatcagctaccccg
gctcaggctcaggcagtacacaaatttatccgcgaccatatcgcgcagaaagatgcgacg
gtggccgctcaggtcatcattcagtacggtggttctgtgaacgataaaaatgcggcagag
ctgtttgctcagccagatatcgacggcgctctggtgggcggcgcatccctgaaagccgat
gccttcgcagcgattgttaaagcggcggcggcggcgaaaagagcctga

DBGET integrated database retrieval system