KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00138Help
Entry
EPYR_00138        CDS       T02121                                 

Gene name
glpK
Definition
protein glpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:epr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(150746..152260)
Genome map
AA seq 504 aa AA seqDB search
MTAEKKYIVALDQGTTSSRAVILDHDANIVAVSQREFQQIYPKPGWVEHDPMDIWASQSS
TLVEVLAHADINSDEIAAIGITNQRETTIVWEKQTGKPIYNAIVWQDPRTADYCAKLKKE
GLEEYIRHTTGLVINPYFSGTKLKWILDHVEGSRERARRGELLFGTVDSWLVWKMTQGRV
HITDYTNASRTMMFNIHQLEWDQRMLEILDIPREMLPEVKSSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTQGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDEMKLIGDAADSEYFATKVKDTNGVYMVPAFTGLGAPYWDP
YARGAIFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWKDLDEVRAKSVIEREFRPGIETTR
RNVLYAGWKKAVARAQAWEEADDR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgaaaagaaatatatcgtcgcgctcgaccagggaaccaccagttcccgcgcc
gtgatcctcgatcatgacgccaatattgtcgcggtgtcgcagcgcgaattccagcaaatc
taccctaagcctggctgggttgagcatgacccgatggatatctgggcttcgcaaagctcc
acgctggtggaagtgctggcgcatgcggatatcaattccgacgagattgccgctattggc
atcaccaatcagcgtgagaccaccattgtctgggaaaaacagaccggcaaaccgatctat
aacgctattgtctggcaggatccgcgcacggctgattactgcgcaaagctaaaaaaagag
gggctggaagagtacattcgccacaccaccggattagtgattaacccctacttctccggc
accaaactaaaatggatcctcgaccatgttgaaggttcgcgcgaacgcgcccggcgtggc
gaactgctgtttggcaccgtcgacagctggctggtatggaagatgacgcaaggacgggtg
cacatcaccgactacactaacgcctcgcgtaccatgatgttcaacattcatcagctggaa
tgggatcagcgcatgctggaaattctcgatattccgcgtgaaatgctgccggaagtgaag
tcgtcctctgaagtttatggccagaccaacattggcggtaaaggcggcacgcgcatccct
attgcgggtattgccggcgatcagcaggcggcgctgtacggccagctgtgcgttcagccg
gggatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcaccgaa
gccgtcacctccacccaaggcctgctgaccaccatcgcctgtgggccgcgtggtgaagtc
aactacgcgctggaaggcgcggtgtttatcggcggcgcgtcgattcagtggctgcgtgac
gagatgaagctgatcggtgacgccgcagactccgaatatttcgccacgaaagtgaaagac
accaacggtgtttatatggtgcccgccttcaccggcctgggcgcaccgtactgggatccg
tatgcccgtggtgccatcttcggcctgacgcgtggtgccaacgctaaccatattatccgc
gccacgctggagtcgatcgcctaccaaactcgtgatgtactggaagcgatgcagaacgat
gccaacacccgcctgcaatcactgcgcgtggacggtggtgcagttgccaataacttcctg
atgcagttccagtccgatattctcggtacgcgcgttgagcgccctgaagtgcgtgaagtg
accgcattgggggcggcctatctggcgggcctggccgttggcttctggaaagacctggat
gaagtgcgtgccaagtcggtgatcgaacgcgaatttcgcccgggcatcgaaaccacccgg
cgtaacgtgctgtacgccggctggaaaaaagccgttgcccgcgctcaggcgtgggaagag
gccgacgacaggtaa

DBGET integrated database retrieval system