KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00220Help
Entry
EPYR_00220        CDS       T02121                                 

Gene name
pldA
Definition
protein pldA (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EPYR_00220 (pldA)
   00565 Ether lipid metabolism
    EPYR_00220 (pldA)
   00590 Arachidonic acid metabolism
    EPYR_00220 (pldA)
   00591 Linoleic acid metabolism
    EPYR_00220 (pldA)
   00592 alpha-Linolenic acid metabolism
    EPYR_00220 (pldA)
Enzymes [BR:epr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     EPYR_00220 (pldA)
    3.1.1.32  phospholipase A1
     EPYR_00220 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243030..243908
Genome map
AA seq 292 aa AA seqDB search
MALPKGLSATALLLPTLVMAQEASIKEVHDNTAVPGSIIANLLEKHDNPFVMYPYESNYL
LYTDTSNLNKEAIRSYSWSDKAKHDEVKFQLSLAFPLWRGIAGDSSVLAASYTQKSWWQL
SNRGASSPFRESDYEPQIFLGWATDYRFAGWTLRDVETGFNHQSNGRSEPTSRSWNRVYA
RLMAENGNWLVEVKPWYRLPESENNDDNPDITKYMGYYRLTVGYQWGDSIFSLKGNYNWN
SGYGGAELGWSYPLTEHVRFYTQVFSGYGESLIDYNLRQTRVGVGVTLNDLF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctttgccgaaaggattgtcggcaacagcattgctgttgccgacgttggtcatggca
caggaagcctcgatcaaagaggtgcatgacaataccgcagtgcctggcagtattattgcc
aacctgttggaaaaacatgataaccccttcgtgatgtacccttacgaaagtaattatctg
ctgtataccgataccagcaacctgaataaggaagctatccggtcttacagctggagcgat
aaagctaagcatgatgaggtgaaattccagctgagcctggctttcccgctgtggcgcggt
attgctggcgacagctcggtgctggccgcctcctacacccagaaatcctggtggcagctt
tcaaatcgcggcgcatcctcaccgttccgcgaaagcgattatgaaccgcaaattttcctc
ggctgggccacggactaccgttttgccggatggacattgcgcgatgtcgaaaccggtttt
aatcatcagtctaacggccgttctgagccaacctcccgcagctggaaccgggtctatgcg
cgcctgatggcggaaaacggcaactggctggtggaagttaaaccctggtaccgtcttcca
gaaagtgaaaataatgacgataacccggatatcaccaagtacatggggtattatcgcctg
acggtgggttaccagtggggtgacagcatcttcagcctgaagggcaactacaactggaac
agcggctacggcggtgccgagctgggctggagctatccactgactgagcatgtgcgcttc
tatacccaggtgttcagcgggtacggggaatccctgatcgactacaacctccgccaaacg
cgcgtgggtgtcggcgtaacgcttaacgacctgttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system