KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00223Help
Entry
EPYR_00223        CDS       T02121                                 

Gene name
pldB
Definition
lysophospholipase L(2) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EPYR_00223 (pldB)
Enzymes [BR:epr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EPYR_00223 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246597..247589
Genome map
AA seq 330 aa AA seqDB search
MELHQKSWLTREKAFAAFATGPLLDFWKQREEGEFAGVADVPIRYVRFISPQHDKVILLC
PGRIESYVKYPELAYDLFHSGYDIFIIDHRGQGRSGRLLKDSHRGHVVAFEDYVDDLETL
FLQQIVTRDYRHRYALAHSMGGAILALMLVRQPAAFAAVALASPMFGLFLPMPLWMARRI
LNWAEKRPTVRDDYALGTGKWRARPFAVNDLTHSRERYRRNVRFYADDPGIRVGGPTYHW
VREGVRAGQSVLRQAEQIATPLLLLQAADDKVVDNRAQDLFCQTMLAAGRPCEGGKPMII
EGAHHEILFEKDRMRAVALEAVLAFFARHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcaccagaaaagctggttaacgcgtgaaaaagcctttgcggcttttgctacc
ggcccgttgctggatttctggaagcagcgcgaagagggcgagtttgccggggtggcagac
gtaccgatccgctacgtccgcttcatctcaccgcagcatgacaaggttatattattgtgt
ccggggcgcattgaaagctatgtcaaatacccggagctggcctacgacctgttccatagt
ggatatgacattttcattatcgatcatcgcgggcaggggcgatcgggcaggctgctgaag
gattcacatcgtgggcacgtcgtggcgttcgaagactacgttgacgatctggaaacgctg
tttttacaacagatcgtcacgcgtgactatcgccatcgctacgcgctggcgcattcgatg
ggcggggcgatcctcgccctgatgctggtacgacagccagcggcctttgctgcggtggcg
ctggcttcgccgatgtttggtctttttctaccgatgcctttatggatggcgcgccgcatt
ctcaactgggcggaaaagcgcccaacggtgcgcgatgattatgcgctgggaaccggcaag
tggcgtgcgcgcccgtttgcggtaaacgatctgacgcacagccgcgaacgctatcgccgc
aatgtgcgcttttatgccgacgatcccggcatccgcgttggtggcccgacctatcactgg
gtgcgcgaaggcgtgcgcgccgggcaaagcgttttgcgccaggctgaacagatcgccacc
ccgctgctgctgctacaggccgccgacgataaggtcgtcgacaaccgcgctcaggatctg
ttctgccagacgatgctggcggcgggtcggccctgtgagggtggcaagccgatgattatt
gagggtgcgcatcatgagatcctgtttgagaaggatcggatgcgcgcagtggcgcttgaa
gccgtcctcgccttttttgcccgccatgcctga

DBGET integrated database retrieval system