KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00390Help
Entry
EPYR_00390        CDS       T02121                                 

Gene name
nahA
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:epr00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:epr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447110..449482
Genome map
AA seq 790 aa AA seqDB search
MLWSPCRILLAFSVILPLCAAAVPAGDLPLMPWPQKVELAADAASLTLIIPLDIQVKGDD
LQEAVPRWQRRLARQTGKAYYPLPASATPLQIHIANRVAPVPQPDSDESYRLVVSRDGVH
LDSATRFGAMRGMETLLQLVQNGALPLVTIDDRPRFPWRGMMIDSVRHFMPLETLKRQID
GIAAARMNVFHWHLTDDQGWRFASSRFPQLQAKASDGLWYSEQQMREIVSYATDRGVRVV
PEIDLPGHVPALAVAMPQLLAIPGRYQPERGWGVFKPLLDPTNEQVYRFIDLLVGEVAAI
FPDPYLHIGGDEVDDTQWRKSERISQFMQRQGLKDGHALQAYFNQRVEKILAKHQRRTIG
WDEIYHPDLPRSILIQSSRGANALGEIAKNNYRGILSAGFYLDQAQPAAFHYRNEVWPQA
LNGADRVRAGETAQSWQFSLPRLKGDPLNGSFTLIDSAGGWRGFIDFAGRSRRMVQNMRW
LSPTQLTFSVDSWMGNLQPVLTLAGDSLNGYWRIGNVRYSTTGSMLAQIPQGIKPALPDE
AQLRENLLGGEAVLWSEIVDENIIDIRLWPRAFAVAERLWSAADVTDEKNMYQRLAAVDN
WSALSVGLQQHTQMQLQMMRLANGNDIAPLHIFAEALEPAQYYTRQHLKHRAGHSTLAEP
LNQLADILPTESSKVRELDRQVDALIANRGDRQAALAIRRQLELWQFNILQVEPLLASNP
QLRPLLTVAEQVGAISKVGLSLVDAMENERIFGAREVAKMQQLLDSEALRQDELVIALLY
PIEKLLWADK
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgctatggtcaccgtgccgcatactgcttgcttttagtgttatcttgccgctctgcgcg
gctgccgtgccggccggggatctgccgctgatgccgtggccacagaaggtggaactggcc
gccgatgcagccagcctgacgctgatcatcccgctggatattcaggtaaaaggcgacgat
ctgcaggaagccgtgccgcgctggcagcggcgtctggcgcgtcagacgggtaaagcgtat
tacccccttccagccagcgccacgccgctgcaaatccatatcgcaaaccgggtcgcccct
gttccccagcctgacagcgatgaaagctatcgtctggtggtcagccgtgacggcgtgcat
ctggacagtgccacgcgctttggcgccatgcgcggtatggaaacgctgttgcagctggtt
caaaatggggcgctgccgctggtgaccatcgatgaccgcccacgttttccgtggcgcggc
atgatgattgattctgtccggcactttatgccgctggagaccctgaagcggcagattgat
ggcatcgccgccgcacgcatgaacgtgtttcactggcatctgaccgatgaccagggctgg
cgctttgcctccagccgctttccgcagctgcaggcaaaagccagcgatggcctgtggtac
agcgagcagcagatgcgcgagattgtcagctatgccaccgatcgcggcgtgcgggtggtg
ccggagatagacttacccggccatgtacccgcgctggcggtcgccatgccgcagctgctg
gccattccggggcgctatcaaccggagcgcggctggggcgtgttcaaacccttacttgat
ccgactaacgaacaggtttatcggtttattgacctgctggtcggcgaggtggcggcgatc
ttccccgacccgtatttacacattggtggcgatgaggtggacgatacgcaatggcggaaa
tccgagcgcatcagccagtttatgcagcggcaaggactgaaggatggccacgccctacag
gcttactttaatcagcgggtggagaagatcctggcaaaacaccagcgccgcaccatcggc
tgggacgaaatttatcatcccgacctgccgcgcagcattctgatccagtcatcgcgggga
gccaatgcgctgggagaaatagcgaaaaacaactatcgcggcatcctgtctgctggtttc
tatctcgatcaggcacagccagccgcttttcattaccgcaatgaagtatggccgcaggcg
ttgaacggcgccgaccgggtgagagcaggtgaaacggcgcaaagctggcagtttagtttg
ccccggctgaagggcgacccgctaaacggcagttttaccctgattgacagcgcgggcgga
tggcgaggttttattgattttgccggacggtcgcggcgcatggtgcaaaacatgcgctgg
ctttcgccgacccagctaaccttcagcgttgacagctggatgggaaatctacagccggta
ctgacgttggcgggcgacagcctgaacggctactggcgtattggcaacgtgcgatattcg
accacgggcagcatgctggcgcagataccgcaaggcataaaacctgccttacccgatgag
gcgcagctcagggagaatctgctgggaggggaagcggtgctgtggagtgaaatcgttgat
gaaaacatcattgatatccgtttgtggccacgggcgtttgccgttgccgagcgactgtgg
tcggcagcggatgtcactgacgaaaaaaatatgtatcagcggctggcggcggtcgacaac
tggtcggcgctatctgtgggcctgcaacagcacacacaaatgcagctacaaatgatgcgc
cttgccaacggcaacgatatcgcaccgctacacatttttgccgaggcgctggaaccggcg
cagtactacacgcgtcagcatctcaagcaccgcgccgggcattcaacgctggcagagcct
cttaaccagctggcggatattttacccaccgagagcagcaaggtacgggaacttgaccgt
caggtggatgcgctgattgccaaccgtggagaccgccaggcggcgctggcgatacgtcgc
cagctggagctatggcagttcaatattctacaggttgaacccttgctggcgagcaatccg
cagctgcgaccgctgttaacggtagcagaacaggtaggggctatcagcaaggtggggctg
tcactggtggatgcgatggaaaatgagcgcattttcggcgcgcgtgaagtcgcgaagatg
cagcagttactcgatagtgaggcgctcaggcaggatgagttggtgatcgcgctactttac
ccgattgagaaattgctgtgggcggacaaataa

DBGET integrated database retrieval system