KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00542Help
Entry
EPYR_00542        CDS       T02121                                 

Gene name
cysQ
Definition
inositol-1-monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:epr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608602..609342
Genome map
AA seq 246 aa AA seqDB search
MLEKICQLAREAGDAIMQVYDGQAPLDVAQKPDDSPVTAADMAAHKVIVAGLQALTPTIP
VLSEEAPQSWEIRQHWQQYWLVDPLDGTKEFIKRNGEFTVNIALIKAGKTVLGVVYAPVL
AVMYCAAEGKAWKEEGGHKIRIQVQDARPPLVVVSRSHADSELEDYLKQLGDHQTTAIGS
SLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVNDWQGKPLDYAPRESFLNPG
FRVSIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaaaaatttgccagctggcgcgtgaagcaggtgatgccattatgcaggtgtat
gacggacaggctccactggatgtggcgcagaagcccgatgactcaccggtgactgccgca
gacatggcggcgcacaaggtgattgtcgccggactacaggcgttaacccccaccatcccg
gttttgtctgaagaagcgccgcagagctgggagatacgccagcactggcagcaatactgg
ctggtggatccgctcgacggcaccaaagagtttatcaaacgtaacggggagtttacggtc
aatatcgcgctgatcaaagcgggaaaaacggtactgggagtggtctatgcgccggtactg
gcggtgatgtattgcgctgccgaaggcaaagcctggaaggaagagggtggccataaaatc
aggattcaggtgcaggatgcgcgcccgccgctggtggtagtcagtcgttcacatgccgac
agcgaactggaagattacctcaagcaactcggcgaccatcagaccaccgcgattggctcc
tcgctgaagttctgcctggtggcagaggggaaagcacagctctatccgcgcttcgggcct
accaatatctgggataccggtgcaggccacgcggtggcggcggcggcgggtgcgcacgtt
aatgactggcagggtaaaccccttgattatgccccgcgcgaatcattcctcaatccgggg
tttcgcgtatccattttttga

DBGET integrated database retrieval system