KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00623Help
Entry
EPYR_00623        CDS       T02121                                 

Gene name
nucD
Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
Enzymes [BR:epr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EPYR_00623 (nucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692858..693367
Genome map
AA seq 169 aa AA seqDB search
MNHSIVKHCAVGAVLAAAAMLPKYQQLHTSPDGLKLLADYEGCHLMPYQCSAGIWTDGIG
NTEGVVSGRSITGQQAAGNLITNVLRVESALAQCLTEPVPQSVYDSLVSLAFNVGTTKTC
GSTMVKLLNEKRWRDACQQLPRWIYVKGVFNPGLKKRRAREMAWCLTGI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcaatcgttaaacattgtgctgtcggcgcggtactggctgctgctgccatg
ctgccgaaatatcagcagctgcatacctcaccagatgggctgaaactgttggcggactat
gaaggctgtcatctgatgccttatcagtgcagcgccgggatatggacggacggcatcggc
aacaccgaaggcgtggtatcgggccgcagcattaccgggcagcaggcagcagggaattta
atcaccaatgtactgcgcgttgaatcagcactggcgcagtgtttgacggaacctgtgccg
cagtcagtgtatgactcgctggtctctctggcctttaacgtcggtaccactaaaacctgt
ggttcgacgatggtgaagctgctaaacgaaaagcgctggcgtgacgcctgccagcagctg
ccgcgctggatctatgttaaaggcgtgttcaacccggggcttaaaaagcgccgcgcaagg
gagatggcgtggtgcctgaccggaatatga

DBGET integrated database retrieval system