KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00728Help
Entry
EPYR_00728        CDS       T02121                                 

Gene name
thrC
Definition
(RefSeq) protein thrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EPYR_00728 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EPYR_00728 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EPYR_00728 (thrC)
Enzymes [BR:epr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EPYR_00728 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
799135..800421
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTEIDDMLEMDFVTRSSKILS
AFIGDEIPPHQLNERLKTAFTFPAPVVEVTDNIAALELFHGPTLAFKDFGGRFMAQMLSY
VSDADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEALKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLANGEWTPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLTDLGYGAVDDETTKAAMRELADLGYLSEPHAAIAWR
LLHEGLQEGEFGLFLCTAHPAKFKESVEEILQRTLPLPDALAERAELPLLSHRMKAEFAD
LRAFLLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtgagcttcgcccaggcggtgaag
caggggctgggcaaacagcagggcctgttctttcctctggagttacctgagtttgaactg
actgaaattgatgacatgctggaaatggatttcgtgacccgtagcagtaaaattctttcg
gcgtttatcggtgatgaaattcctccgcatcagctgaatgagcgtttgaaaacggcgttt
accttcccggcaccggtggtggaagtcactgataatatcgccgcgctggagctgttccac
ggcccgacgctggcgtttaaagactttggcggccgctttatggcgcagatgctctcttat
gtcagcgatgcggacgagcagatcactattctgactgcgacttcaggcgataccggagcc
gccgttgctcatgctttctacggcatggaaaacgtgcgcgtggtgatcctttatccacag
ggcaagatcagcccgctacaggaaaaactgttctgtaccctcggtggcaatatcgagacc
atcgccattgacggcgatttcgatgtttgccagtcgctggttaaacaggcgtttgacgat
gaagcgctgaaaaaggccattggcctgaattcggcgaactcgattaatatcagccgcctg
ctggcgcagatctgctactactttgaagccgtggcgcagctgccgcaggaaaaacgtaat
cagctggtgatttcggtgccgagcggtaactttggcgacctgacggctggcctgctggcg
aagtctctcggcctgccggtgaagcgttttatcgctgccaccaacgccaatgacaccgta
ccgcgcttcctggccaacggcgagtggacgcccaacgccaccgtggccacgctgtcaaac
gcgatggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccggcgtaaa
acctggcgcttaacggatctcggctatggtgcggtcgacgatgagaccaccaaagcggcc
atgcgtgagctggccgatctcggttacctttccgagccacatgcggctatcgcctggcgc
ctgctgcatgagggattacaggaaggggagtttggtctgttcctctgcaccgcgcacccg
gcgaaatttaaagagagcgtggaagagatcctgcaacgcaccctgccgctgccggatgca
ctggccgagcgtgccgagctgccgttgctgtctcaccgcatgaaagcggaatttgccgac
ctgcgtgcgttcctgctgaagaagtaa

DBGET integrated database retrieval system