KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00844Help
Entry
EPYR_00844        CDS       T02121                                 

Gene name
vraB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EPYR_00844 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    EPYR_00844 (vraB)
   00640 Propanoate metabolism
    EPYR_00844 (vraB)
   00650 Butanoate metabolism
    EPYR_00844 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    EPYR_00844 (vraB)
   00072 Synthesis and degradation of ketone bodies
    EPYR_00844 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EPYR_00844 (vraB)
   00310 Lysine degradation
    EPYR_00844 (vraB)
   00380 Tryptophan metabolism
    EPYR_00844 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EPYR_00844 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EPYR_00844 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EPYR_00844 (vraB)
Enzymes [BR:epr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EPYR_00844 (vraB)
Exosome [BR:epr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EPYR_00844 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
927849..929045
Genome map
AA seq 398 aa AA seqDB search
MAAIQSLLNYQPEDDRQPVIVAARRTPVGRAYGSLASVPPEALLAPLFNKLLPAGMTAID
EVIIGNATGGGGNIARLAALAAGVPMTVPAVTVDRQCGSGLEAVINACRLVQARAGECYL
AGGVESVSNAPWRVEKPATLKQMPRFYPRARFSPDEIGDPDMGIAAENVARQCAISRERQ
DRFALRSHQRALAAAQQGAFREEIVPLNLGHCLVENDECPRPGTSLAQLAALPPVFAADG
SVTAGNCCPLNDGAALLLVMSRRRARECGFTQGLLFADACSAGVDPNLLGLGPVPATEKL
LRRQPGLTLDGVEVIEFNEAFAAQVLASVDALGIDEHRINQQGGAIALGHPYGASGAIMV
TRLFSQLVSQRQSEGYGLAMLGIAGGLGLSALFKGVQL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctatacagagcttactgaattatcagcctgaggatgaccggcagccggtgatt
gtggccgcccgccgtactcctgtcggcagggcttatggttctctggccagcgtgccgccg
gaggcgctgctggccccgctgtttaacaaactgctgccagcaggtatgacggcgattgat
gaggtgattatcggcaacgccaccggcggcggcggcaatattgcgcggctggcggcgctg
gcggcgggcgtgccgatgaccgtgcctgccgtaacggtggacaggcagtgcggctccggg
ctggaagcggtgattaacgcctgtcggctggtgcaggccagggcgggcgaatgctatctg
gccggcggcgtagagagcgtcagcaacgcgccctggcgggtggagaagcccgccacgcta
aagcagatgccgcgcttttaccctcgtgcacgtttttcaccggatgagatcggcgatccg
gacatgggcatcgccgcggaaaacgtcgcgcgtcagtgcgccatcagccgggaacgccag
gatcgctttgcgctgcgcagccaccagcgcgcgctggccgccgcgcagcagggcgcattc
cgtgaggagatcgtcccgcttaacctgggccattgcctggtcgaaaatgacgagtgcccg
cgccccggcacctcgctggcgcagctggcggcattaccgccggtatttgccgccgatggc
tcggtgacggcgggtaactgctgtccgctgaatgacggggctgcgctgctgctggtgatg
agccgacgcagggcgcgggagtgcggatttacccaggggctgctgtttgccgatgcctgt
agcgcaggcgttgacccgaatttacttggcctcggcccggttcccgccacggaaaaactg
ctgcggcgtcagccgggcctgacgctggacggggttgaggtcattgagttcaatgaagcc
tttgccgcccaggtgctggcatcggttgatgcactgggtatagatgaacacaggatcaac
cagcaggggggcgctattgctttggggcatccgtacggcgcttccggggcgataatggtg
acgcggctgttcagccagctggtcagccagcggcagagcgaaggctacggcctggcgatg
ctgggaatagctggcgggctggggctgagcgcattgtttaagggcgtgcagctgtaa

DBGET integrated database retrieval system