KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00922Help
Entry
EPYR_00922        CDS       T02121                                 

Gene name
ispC
Definition
protein ispC (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EPYR_00922 (ispC)
Enzymes [BR:epr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EPYR_00922 (ispC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008565..1009779
Genome map
AA seq 404 aa AA seqDB search
MKQLTILGSTGSIGTSTLAVVRANPQRFAVKALVAGRNVEMMTRQCLEFRPAYAAMSDER
AANELRLRLNDLNVATEVLSGEQAAGDLTALDDVDQVMAAIVGAAGLLPTLAAIRAGKQV
LLANKESLVTCGRLFMEAVSASQAQLLPIDSEHNAIFQSLPASLQQQLGYASLENNGIES
IILTGSGGPFRDTPLAELRHMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ATDAQMEVILHPQSVIHSMVRYRDGSVIAQLGSPDMRTPIAHAMAWPHRVSSGVQPLDFT
RMSALTFAEPDYARYPCLKLAIDASKAGQAATTTLNAANEIAVAAFLASEIRFTDIAALN
IAVLETLSCQEPRSVDAVIAIDGEARAAARALLPRFAAGHGGVS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgaccatccttggctcgaccggttcaatcggcaccagtacgcttgccgtg
gtgcgcgctaacccacagcggttcgccgtcaaggcgctggttgccgggcgcaacgttgaa
atgatgaccaggcaatgcctggagttccgcccggcatatgccgcgatgtcggatgagcga
gcggcgaatgaactgcggctgcgtctcaacgatctcaatgttgccaccgaggtattaagc
ggtgagcaggctgctggcgatctgaccgcgctggatgatgtcgaccaggtgatggcggcg
atcgtcggcgcggcaggattattacctaccctggccgccatccgtgccggaaaacaggtg
ctgctggcgaataaagaatcgctggtcacctgcggccgcctgtttatggaggcggtaagc
gcttcgcaggcccagctgttaccgatagacagcgagcacaacgcgatttttcagagtttg
cctgcttccctccagcagcagttagggtacgcttctctggagaataatggtattgaaagc
attattctcacggggtctggtggcccttttcgtgacacgccgttggctgaattgcgtcat
atgacgccagaccaggcatgcgcgcatccgaactggtcaatggggcgtaaaatctccgtc
gattcggccaccatgatgaataaaggcctggaatatatcgaagcccgctggctgtttaat
gccaccgatgcgcagatggaagtgattttgcatccgcagtcggtgatccattcaatggtg
cgttaccgtgatggcagcgtgatcgcccagcttggttcgccggatatgcgtacgccaatc
gctcatgctatggcctggccacaccgcgtcagttcaggtgtacaaccacttgattttaca
cggatgtcggcgttgactttcgcagagcctgactacgcacgttatccctgtctgaagttg
gcgattgacgccagcaaagccggacaggcggcgacaaccacgttaaatgcggcgaatgag
attgcggtagcggcgtttctggcgtcagaaatccgctttaccgatatcgctgcgctgaat
attgcggtgctggagacgttgtcctgtcaggaaccgcgcagcgtcgatgcggtgattgcc
attgacggcgaagccagagcagctgcgcgtgctttattgccacgctttgcggctggtcat
ggcggcgtgagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system