KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01239Help
Entry
EPYR_01239        CDS       T02121                                 

Gene name
glk
Definition
protein glk (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_01239 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_01239 (glk)
   00052 Galactose metabolism
    EPYR_01239 (glk)
   00500 Starch and sucrose metabolism
    EPYR_01239 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EPYR_01239 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EPYR_01239 (glk)
   00524 Butirosin and neomycin biosynthesis
    EPYR_01239 (glk)
Enzymes [BR:epr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EPYR_01239 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349669..1350634
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEIENGAISQAKTFSTADYGSLEAVIRAYLAEQQQDIKHGC
IAIACPITEDWVEMTNHDWAFSTSSLKANLAFDSLEIINDFTAVSMAIPMLTEQDLMQFG
GSVPVADKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLREE
LGHVSAERILSGSGLVNLYRAIVKSDHRLPENLKPRDVTERALQDTCTDCRRALSMFCVA
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYVAPIPVYLIT
HNYPGLLGAGGHLRQTLGRVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtgggggatgtcggcggcacgaatgcgcgcctggcactatgt
gaaattgaaaacggtgccatctcccaggccaaaacgttctccactgccgattatggcagc
ctggaggcggtgatccgtgcttatctggcggaacaacagcaggatatcaaacacggttgt
attgccatcgcctgcccgattaccgaagactgggttgaaatgaccaaccatgactgggca
ttttcaaccagtagcctgaaagcgaacctggcctttgattcgctggagatcattaacgat
tttaccgccgtctcaatggccatcccgatgctgacagagcaagatctgatgcagttcggt
ggcagcgtgccggtagcggataaacccgttgccgtttatggtgccggaaccggcctcggc
gttgcgcatctggtgcatgtggacaaacgctgggtcagtctgcctggcgaaggggggcat
gttgattttgccgccaatagcgaggaagaagatctgatacttgaagtgctgcgcgaagag
ttgggccacgtatccgccgagcgaattctctccggcagcggcctggttaacctctatcgg
gcgattgttaagtcagaccatcgcctgccagaaaatctgaaaccacgcgatgtgaccgag
cgcgcattgcaggacacctgtaccgactgccgtcgggcgctgtcgatgttctgtgtggct
atggggcgctttggcggcaacctggcgcttaacctcggcacctttggcggcgtctatatt
gccggcggcatcgtgccgcgcttccttgaattctttaaagcatccggcttccgcgcggcg
tttgaagataaggggcgcttcaaggattatgtcgcgccaatcccggtctatctcatcacc
cacaattatcctgggttactgggtgccggcgggcatctgcgtcagacgctgggccgcgtg
ctgtaa

DBGET integrated database retrieval system