KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01280Help
Entry
EPYR_01280        CDS       T02121                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00071  Fatty acid degradation
epr00280  Valine, leucine and isoleucine degradation
epr00281  Geraniol degradation
epr00310  Lysine degradation
epr00362  Benzoate degradation
epr00380  Tryptophan metabolism
epr00410  beta-Alanine metabolism
epr00640  Propanoate metabolism
epr00650  Butanoate metabolism
epr00903  Limonene and pinene degradation
epr00930  Caprolactam degradation
epr01040  Biosynthesis of unsaturated fatty acids
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01120  Microbial metabolism in diverse environments
epr01130  Biosynthesis of antibiotics
epr01200  Carbon metabolism
epr01212  Fatty acid metabolism
Module
epr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EPYR_01280 (fadJ)
   00650 Butanoate metabolism
    EPYR_01280 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EPYR_01280 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EPYR_01280 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EPYR_01280 (fadJ)
   00310 Lysine degradation
    EPYR_01280 (fadJ)
   00380 Tryptophan metabolism
    EPYR_01280 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EPYR_01280 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EPYR_01280 (fadJ)
   00281 Geraniol degradation
    EPYR_01280 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EPYR_01280 (fadJ)
   00930 Caprolactam degradation
    EPYR_01280 (fadJ)
Enzymes [BR:epr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EPYR_01280 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EPYR_01280 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EPYR_01280 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DVL
Motif
Other DBs
NCBI-ProteinID: CAY73660
UniProt: D2T7I0
Position
1389804..1391951
Genome map
AA seq 715 aa AA seqDB search
MDLPSALTLTLRPDRVGVITIDVPYEKVNTLKAEFAADILALVQQARANPHLAGLVLISG
KPDSFIAGADINMIAACHSVQQATALAQAGQKAMAEIAALPFPVVAAIHGACLGGGLELA
LACHRRICTQDDKTRLGLPEVQLGLLPGSGGTQRLPGVTGIRVALDMILTGKTLGARAAL
RCGLVDETVDHAILLEAAVQRVLQPLAAAKPLPFSERLLTRAPGRSLLFMLAQRRTRSKT
HGNYPATEKILSVVRCGLTPGSNGYLAEAQAFGELVMTPQSAALRSLFFANTALKKAHFG
VEPHELKRIGILGGGLMGGGIACVTATRAGLPVRIKDVNANGINHALKTSWQVLTRAVER
RRLSAAQRQQQMALITGSTDYQGFRQCDMVIEAVFEDLALKQKMVAEIEANCSVQTLFAS
NTSSLPIADIAAAAQRPENVIGLHYFSPPEKMPLVEVIPHAGTSRETLATAVMLARKQGK
TPIVVADRAGFYVNRILAPYIIEALHCLLEGEPVEYIDRSLVQFGFPLGPLQLLDEVGLD
VGTQIMPILQHAWGERFALPAGLEALWQDGRKGRKNGRGFYLYQQKGRKKRVDSTLYRLL
PVKVKQHLSAAHIAQRCVMMLLNEAARTLDEQGIASARDGDIGAVLGIGFPPFLGGPFRY
MDQLGIGEVVNRLTLLVQQHGSRFAPCSLLEKMAVEGKTFYQSDVKSDKPADSAG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccatctgcattgactcttactctgcgcccggatcgggtcggcgtcatcacc
atcgatgtaccgtatgagaaggttaacaccctgaaagctgaatttgccgcagatattctg
gcgcttgtccagcaggcgcgggccaacccgcatctggccgggctggtactgatttccggt
aagcccgacagttttatcgccggggcggatatcaacatgatcgccgcctgtcatagcgta
cagcaggcgaccgcattggctcaggccggtcaaaaggcgatggcggagatagccgcactg
ccgtttccggtcgtcgcggcgatccacggtgcctgccttggcggcgggcttgaactggcg
ctggcctgccatcgccgcatctgtacgcaggatgacaaaacccggcttggcttaccggaa
gttcagctgggcctgctgccgggttccggcgggacgcagcgcctgccgggcgtgacgggc
atccgggtggcactggatatgatattgacgggcaaaacgctgggggcgcgtgccgcatta
cgctgcgggctggtggacgagacggtggatcacgctattctgctggaagcggcggtacag
cgggtgctacaaccgcttgcggcagcgaagcctttaccctttagcgaacggctgttaacc
cgcgcgcccggccgctcgctgctgtttatgctcgcacagcgccggacgcggtcgaaaacc
cacggcaactatccggctacggaaaaaattctcagcgtggtgcgctgcgggctgacgcca
ggcagcaacggctatttagccgaagcacaggcctttggtgaactggtgatgaccccgcag
tctgccgcgctgcgcagcctgttttttgccaacactgcgctaaaaaaagcgcattttggt
gttgaaccccatgaactgaaacgcattggcatactgggcggtggcctgatgggcgggggg
attgcctgcgttactgcgacgcgtgccgggttgccggtgcgcatcaaagacgtcaatgcc
aacggcattaaccatgcgctgaaaaccagctggcaggtgctgacccgcgcggtggagcgc
cgccgcctgagtgcggcacagcgccagcagcagatggcattaatcaccggcagcaccgat
taccagggcttccggcagtgcgatatggtcatcgaagcggtatttgaagacctggcgctg
aagcagaaaatggtggcggaaatcgaagcgaactgtagcgtacaaacgctgtttgcctcc
aatacctcttcgttgccgatagcggatattgccgccgccgcgcagcggccagagaacgtt
atcggcctgcattacttcagcccaccggagaaaatgccgctggtggaggtgatcccgcat
gcgggcacctccagagaaaccctcgccacagcggtgatgctggcacgaaaacagggcaag
acgccaatcgtcgtcgccgaccgggcgggcttctacgttaaccgtattcttgccccctat
attatcgaagcgctgcactgcctgctggagggggagccggttgaatatatcgaccggtcg
ctggtgcagttcggtttcccgcttggcccgttacagctgctggacgaggtcgggctggat
gtgggtacacagattatgccgatccttcaacatgcatggggcgaacgtttcgcgctgcca
gcgggactggaagcgctatggcaggatgggcgcaaaggacggaaaaacgggcgcgggttc
tatttgtatcaacagaaaggcagaaaaaaacgcgtcgacagcacgctgtaccgcctgctg
cccgtcaaggtaaaacagcatcttagcgcggcgcatatcgcccaacgctgtgtgatgatg
ttgttgaatgaggcagcacgaacgctggatgagcaggggatcgccagcgcgcgcgatggt
gatatcggcgcggtattgggcattggctttccgccttttcttggcgggccgttccgctat
atggaccagttgggtatcggtgaagtggtcaatcgtttaacgctgcttgtgcagcagcac
ggttcgcgttttgcgccttgttcactgctggaaaaaatggcggttgaaggcaaaaccttt
tatcaaagcgatgttaaatctgacaaacccgccgattcagctggttag

DBGET integrated database retrieval system