KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01437Help
Entry
EPYR_01437        CDS       T02121                                 

Gene name
folE
Definition
protein folE (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EPYR_01437 (folE)
Enzymes [BR:epr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EPYR_01437 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1551871..1552536
Genome map
AA seq 221 aa AA seqDB search
MATLSQEATLVHQALVARGLETPLRSPAREMDDDTRKRLIAGHMTEIMQLLNLDLEDDSL
AETPQRIAKMYVNEVFSGLNYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
QATVAYIPKDKVIGLSKINRIVQFFSSRPQVQERLTQQILVALQTLLGTSNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRSVRHR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttgagtcaggaagccacactcgttcatcaggcgctggtcgcccgtggtctg
gaaaccccgctgcgttcaccggcgcgtgaaatggacgacgatacccgcaaacggctgatt
gccggccatatgaccgaaatcatgcagctgctgaatctcgatctggaagatgacagcctg
gcggagacaccgcagcgtattgccaaaatgtacgtcaatgaagtgttttccggcctgaat
tatgccaacttcccgaaaatcaccgtaattgaaaataagatgaaggttgatgagatggtg
acggtgcgtgatatcacgctgaccagcacctgtgaacatcactttgtgatcattgatggt
caggccaccgtggcgtatatcccaaaagacaaggtcatcggcctgtctaaaatcaaccgc
atcgtgcagtttttctcctcgcgcccgcaggtgcaggagcgactgacgcagcagatcctc
gtggcgttacagacgctgctcggcaccagcaacgtggcggtttcgattgacgcggtgcac
tactgcgtcaaggcgcgtggcatccgtgatgccaccagcgccaccaccaccacctcactg
ggtggattgtttaaatccagccagaatacccgccaggaatttctgcgctcggtgcgccat
cgttaa

DBGET integrated database retrieval system