KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01491Help
Entry
EPYR_01491        CDS       T02121                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EPYR_01491 (galF)
   00052 Galactose metabolism
    EPYR_01491 (galF)
   00500 Starch and sucrose metabolism
    EPYR_01491 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EPYR_01491 (galF)
Enzymes [BR:epr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EPYR_01491 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606923..1607819
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHLLPATKAIPKEMLPIVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLADALLCARPM
LHDEAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPEADLSEYSVITT
EESLDFPGKVSSILDFVEKPENPEMLNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLT
DAIASLNKKMPVDAQLLSGDSFDCGRKLGYMKAFVTWGLRNHSQGREFRDEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctgaaagcagttataccggttgcgggtctcggaatgcatctgctccctgcg
acaaaagctattcctaaagagatgttgcccatagtcgataagccaatgattcaatacatc
attgatgagtgcgtggcggcgggtataaaggaaatcgttctggtcacccatgcatccaag
aatgcggttgaaaaccattttgatacttcctatgaacttgaagccttgcttgaagcccgc
gttaaacgctccctgctgagtgaggtaaaatcgatctgcccaccaggtgtaacgattatg
aacgtgcgccaaccccagccgctggggcttgccgatgctttgctgtgcgcccgtccaatg
ctgcatgatgaggcgtttgtggtggtgctgcctgatgtgctgctggataatgccagcgcc
gatccgttgcgctacaacctggcggcgatggtagcacgttttgaagaaaccggacgtagt
caggtgctggctcatcacatgccggaagccgatctttcagagtactccgtgattaccact
gaggagtcattggacttccctggcaaagtcagctccattctggatttcgttgaaaaaccc
gaaaacccagagatgctgaactccgatcttgccgctgtggggcgctatgtgttatcagcc
gatatttggcccgagctggaagcgctggagccgggtgcgtgggggcgctaccagttaacc
gatgccatcgccagcttaaacaagaagatgcctgtagatgctcaattgctcagtggcgat
agctttgattgcggacgtaaacttggttatatgaaagccttcgttacctggggcttgcgt
aaccatagtcaggggcgtgagttccgcgacgagatccagaaaatcctggcgaaataa

DBGET integrated database retrieval system