KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01641Help
Entry
EPYR_01641        CDS       T02121                                 

Gene name
hemB
Definition
protein hemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:epr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1737945..1739054
Genome map
AA seq 369 aa AA seqDB search
MPPGAAIHAERLSSDTLGYTVSTRFISSSPVPIPGGCPAKKEVVLSSYFPIQRPRRLRHS
ASLRSLFQENTLSLNDLALPIFVEEGLDDYKPIAAMPGVMRIPEKRLAYEIERIAKAGVR
SVMTFGISHHTDADGSDTWNENGLVARMSRICKQTVPEMIVMSDTCFCEYTSHGHCGVLH
DHGVDNDATLKNLGRQAVVAAAAGADFIAPSAAMDGQVAAIRHALDAAGFTDTAIMSYST
KFASSFYGPFREAAGTSLKGDRKTYQMNPMNRREAIRESLIDEAEGADALMVKPAGAYLD
ILREVRDRTQLPLAAYQVSGEYAMIKFGAQAGAISETEVVLESLGAIKRAGADIIFSYFA
LDLAEKNIL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccaggggcggcaattcatgctgaaagattgtcatctgataccctggggtatact
gttagcacacgatttatttcatcatcaccggtgccgatacccggtggatgccccgctaaa
aaagaggttgttttgtccagctattttcctatccagcgtccacgacgcctgcgtcattcc
gcttctcttcgctctctgtttcaggaaaacaccctcagtctgaacgatctggcgctgccg
atctttgttgaggaaggccttgacgactataagccgattgctgccatgccgggggtgatg
cgcattccggaaaagcgcctggcgtatgagattgaacgtattgccaaagcgggcgtgcgg
tcggtgatgaccttcggtatttctcaccataccgatgctgacggcagcgatacctggaac
gagaacgggctggtggcgcgtatgtcacgtatttgcaaacagacggtgccggaaatgatt
gtgatgtccgatacctgtttttgtgagtataccagccacggccactgcggcgtgctgcat
gaccacggcgtggataatgacgccacgctaaaaaaccttggcaggcaggcggtggtggcc
gccgcagcaggggctgattttatcgcgccgtcggcggcaatggacggccaggtggcggcg
atccgtcacgcgctggatgcggctggctttaccgataccgccatcatgtcctattctacc
aagttcgcctcctccttctacggcccgttccgcgaagcggcaggcacctcgctgaaaggc
gatcgcaaaacctaccagatgaatccgatgaaccgccgcgaagcgattcgtgaatcgctg
atcgacgaagcggaaggggcggatgcgctgatggttaaaccggcgggtgcctatctggat
attctgcgcgaagtacgtgaccgcacccaactgccgctggcggcctatcaggtgagcggt
gagtacgcgatgattaagttcggtgcgcaggcgggtgccattagcgaaaccgaagtggtg
ctggaaagcctgggggcgatcaaacgcgccggtgccgatattattttcagctactttgct
cttgacctcgccgagaagaatattctctga

DBGET integrated database retrieval system