KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01663Help
Entry
EPYR_01663        CDS       T02121                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:epr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:epr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1763436..1764485
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIVNSHADMEMVASAPDPLVARDLIKQFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGQGSEITLRALELGAVDFVTKPSLGIRDGMLAYS
QTIADKVRAASRARLHPRSAQPAPVMLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPI
TSPALLITQHMPAGFTRSFADRLNKLCQITVKEAEDGERILPGHAYIAPGAMHLELARSG
ANYQVKLNDGPSVNRHKPSVDVLFNSVAHFAGRNAVGVILTGMGSDGAAGMLAMNKAGAW
TIAQNEASCVVFGMPREAIALGGASEVVDLHQISQHMLAKISVGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtactatgcgttgatgattcggccctgatgcgtcagttaatgacc
gaaattgtcaacagtcatgccgatatggagatggtcgcttcagcgccggatccgctagtg
gcaagggatttgatcaagcaattcaatccggatgtattaaccctggatgttgaaatgccg
cgcatggacggcctcgactttctggaaaagctgatgcgtctgcgcccgatgccggttgtt
atggtctcatcactgaccgggcaaggctcagagatcactctgcgtgcgctggagctgggg
gcggtggacttcgtcaccaagccgtcgctggggatccgcgatgggatgctggcctacagc
cagactatcgctgacaaggtgcgcgccgcttcccgcgcccgcctgcatccgcgcagcgcg
cagcccgcaccggtgatgcttaaggctggaccgctgctaagcagtgaaaagctgatcgcc
attggtgcgtcgaccggcggtacggaggccattcgccatgtgctgcaaccgttgccgata
accagtccggcactgctgattacgcaacatatgcccgccggcttcactcgctcctttgcc
gaccgcctgaataagctgtgccagatcacggtgaaagaagcggaggatggggaacgtatt
ctgcccggccacgcctatattgcaccgggtgccatgcaccttgagctggcgcgtagcggt
gccaattaccaggtcaaattgaatgacgggccatccgtgaatcgtcacaaaccgtcagtt
gacgtgctgttcaactccgtggcgcattttgccggacgaaatgccgtcggggtgatcctc
accggtatgggaagcgatggcgctgccggaatgctggcgatgaacaaggcgggagcctgg
actatcgcccagaatgaagcaagctgtgtggtatttggcatgccccgtgaggcaatagcc
cttgggggagccagtgaagtggtcgatcttcaccaaatcagccagcacatgctggcaaaa
attagcgtcggacaggcgttacgtatctag

DBGET integrated database retrieval system