KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01685Help
Entry
EPYR_01685        CDS       T02121                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:epr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1783216..1783830
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPAVLIEASGVGYEVQMPMTCFYELPELQQEAVIFTHFVVREDAQLL
FGFNSKPERALFRELIKVNGVGPKLALAILSGMSAQQFVTAVERGEIAALVKLPGVGKKT
AERLVVEMKDRFKGMHGDLFASDAPFALTSEMTKETGNDAESEAVAALIALGYKPQEASR
MIVKTGKPDADCETLIREALRAAI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgtctgagaggcattatcctggaaaaacagccgccagcggtgttaattgaa
gccagcggtgtcggttatgaggtgcaaatgccaatgacctgtttttatgagcttcccgaa
ctccagcaggaagcggtgatcttcacccattttgtggtgcgtgaagatgcccaactgctg
tttggctttaacagtaagccggagcgcgcactgttccgggaactgatcaaagtgaacggc
gttgggccgaaactggcactggctattctgtccggtatgtcggcgcagcagtttgtgacc
gccgttgagcgcggcgagattgcggcgctggtcaagctgccgggcgtcggcaaaaaaacc
gccgagcgtctggtggtcgaaatgaaagaccgctttaaagggatgcacggcgatctgttt
gccagcgacgcaccgtttgcgctgaccagtgaaatgaccaaagagacgggcaacgatgcc
gaaagcgaagcggtagcggcgctgatcgccctggggtacaagccacaggaggccagccgg
atgatcgttaagacaggtaagcctgatgccgattgcgaaacgttaattcgtgaagcgctg
cgcgcagctatttga

DBGET integrated database retrieval system