KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01754Help
Entry
EPYR_01754        CDS       T02121                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:epr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1856435..1857313)
Genome map
AA seq 292 aa AA seqDB search
MNENIFSLPVLNPLTPYLSQRQLGELPVIVITHPKVRAAVTLQGAQLIAWQPTGEKPVIW
LSDKTPLRDGKAIRGGVPVCWPWFGPAGEPAHGFARHLPWELFAHDENEQCVMLTLVLKS
SERTRKLWPHDFTLFARFRFGEHCEIELEAHGAFESTAALHSYFAVADIGGVSVSGLGPG
YIDKVKDGVTGTSDDGVQTYPQRTDRTYTQPDDCSVISDNSGERVIEVHHHYHSDVVTWN
PGPALSCSMADMANDGYKTMVCVETAHISQPMISSDDRPARLATTFRVRRKK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacatattctccctgcctgtgcttaacccgttgaccccctacctctcacag
cgccagctgggcgagttaccggtcattgtcatcacccatcccaaagtacgcgcggccgtt
acccttcagggcgcccagctgattgcctggcagcccacgggtgaaaagcccgttatctgg
cttagcgataaaactcctctgcgtgacggaaaagcgattcgcggcggtgtgcctgtttgt
tggccctggtttggcccggccggcgagccggcacatggctttgcccgtcatctgccctgg
gagctttttgcacatgatgagaacgaacagtgcgtcatgttgacgctggtattgaaaagc
agcgagagaaccaggaagttatggccacacgattttaccctgtttgcccggttccgcttt
ggcgaacactgtgagattgaacttgaagcacatggtgcatttgagtcaactgccgcactg
cacagttacttcgccgtggcggatatcggcggcgtttcggtcagtggcctggggccgggt
tatattgataaagtcaaagatggggtgacgggaacgtctgacgacggcgtacaaacctat
cctcagcgcaccgaccgtacttacacgcagcctgacgattgcagcgtcattagcgataac
agcggagagcgggtgattgaagtgcatcaccattaccacagtgacgttgtcacatggaat
ccgggacccgcgttatcatgtagcatggccgatatggccaatgacggatataaaaccatg
gtttgtgtcgaaacggcgcatatcagtcagccaatgatcagcagcgacgacaggccagcc
cgactggcaaccaccttcagggttcgtcgaaaaaagtga

DBGET integrated database retrieval system