KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01754Help
Entry
EPYR_01754        CDS       T02121                                 

Gene name
yeaD
Definition
(GenBank) UPF0010 protein yeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00010  Glycolysis / Gluconeogenesis
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01120  Microbial metabolism in diverse environments
epr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_01754 (yeaD)
Enzymes [BR:epr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EPYR_01754 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAY74134
UniProt: D2TAF5
Position
complement(1856435..1857313)
Genome map
AA seq 292 aa AA seqDB search
MNENIFSLPVLNPLTPYLSQRQLGELPVIVITHPKVRAAVTLQGAQLIAWQPTGEKPVIW
LSDKTPLRDGKAIRGGVPVCWPWFGPAGEPAHGFARHLPWELFAHDENEQCVMLTLVLKS
SERTRKLWPHDFTLFARFRFGEHCEIELEAHGAFESTAALHSYFAVADIGGVSVSGLGPG
YIDKVKDGVTGTSDDGVQTYPQRTDRTYTQPDDCSVISDNSGERVIEVHHHYHSDVVTWN
PGPALSCSMADMANDGYKTMVCVETAHISQPMISSDDRPARLATTFRVRRKK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacatattctccctgcctgtgcttaacccgttgaccccctacctctcacag
cgccagctgggcgagttaccggtcattgtcatcacccatcccaaagtacgcgcggccgtt
acccttcagggcgcccagctgattgcctggcagcccacgggtgaaaagcccgttatctgg
cttagcgataaaactcctctgcgtgacggaaaagcgattcgcggcggtgtgcctgtttgt
tggccctggtttggcccggccggcgagccggcacatggctttgcccgtcatctgccctgg
gagctttttgcacatgatgagaacgaacagtgcgtcatgttgacgctggtattgaaaagc
agcgagagaaccaggaagttatggccacacgattttaccctgtttgcccggttccgcttt
ggcgaacactgtgagattgaacttgaagcacatggtgcatttgagtcaactgccgcactg
cacagttacttcgccgtggcggatatcggcggcgtttcggtcagtggcctggggccgggt
tatattgataaagtcaaagatggggtgacgggaacgtctgacgacggcgtacaaacctat
cctcagcgcaccgaccgtacttacacgcagcctgacgattgcagcgtcattagcgataac
agcggagagcgggtgattgaagtgcatcaccattaccacagtgacgttgtcacatggaat
ccgggacccgcgttatcatgtagcatggccgatatggccaatgacggatataaaaccatg
gtttgtgtcgaaacggcgcatatcagtcagccaatgatcagcagcgacgacaggccagcc
cgactggcaaccaccttcagggttcgtcgaaaaaagtga

DBGET integrated database retrieval system