KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01769Help
Entry
EPYR_01769        CDS       T02121                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EPYR_01769 (galU)
   00052 Galactose metabolism
    EPYR_01769 (galU)
   00500 Starch and sucrose metabolism
    EPYR_01769 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EPYR_01769 (galU)
Enzymes [BR:epr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EPYR_01769 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1871091..1871999
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVSDVTAYGV
VDCQGAQLSPGDSAPMVGVVEKPKADKAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGASHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgctggtttgggaacg
cgtatgttgcctgctaccaaagcgattccgaaagagatgttgccactggttgataagccg
ttgattcagtatgtcgttaacgagtgtattgctgctgggatcaacgaaatcgtgctggtt
acgcactcttccaagaactcaattgaaaaccacttcgacaccagcttcgagctggaagcc
atgctggaaaaacgtgttaaacgtcagctgctggaagagattcagtcaatctgtccacca
cacgttaccattatgcaggttcgtcaggggctggctaaaggtcttggccatgcggttatg
tgtgcatggccggtcattggtaacgagccggtagccgttatcctgccggatgttattctg
gatgaatacgaatcagatctgtcgaaagataacctggcagaaatgattcgccgcttcgat
gaaaccggccacagccagatcatggttgaacccgtttctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcaattaagcccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacctaaagccgataaagccccttcaaatctggcagtcgtcgggcgttacgtgctg
tctgctgatatctggccactgctggctaaaactcctccaggtgccggtgatgaaatccag
ctgaccgactcaatcgctatgctgatggagaaagagacggtagaagcttatcacctgaag
ggtgccagccatgactgtggtaacaagctcggctatatgcaggctttcgttgaatatggt
gtgcgtcacgaaactctgggcagcgatttcaaagcctggctggaaagcgctgtgggtaac
aaaaagtaa

DBGET integrated database retrieval system