KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01795Help
Entry
EPYR_01795        CDS       T02121                                 

Gene name
trpA
Definition
(GenBank) trpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00260  Glycine, serine and threonine metabolism
epr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01130  Biosynthesis of antibiotics
epr01230  Biosynthesis of amino acids
Module
epr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EPYR_01795 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EPYR_01795 (trpA)
Enzymes [BR:epr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EPYR_01795 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAY74175
UniProt: D2TAJ6
Position
complement(1893836..1894642)
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPKLSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQNANLRAFAAGVTPEQCFEMLAAIREKYPQLPIGLLMYANLVFSNGIDNFYSRCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNASDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLKHLVDKLREYHAAPALQGFGISEASQVQQAIAAGARGAISGSAVVKI
IEKHLTEPAVMLSELTAFAASLKDGTRC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctacgacctctgttttaaacgcctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccaaactgtcgttacagattatcgatgcgctg
gtggcaggcggtgctgatgcgcttgagctgggcattcccttttccgacccgctggcagat
ggccccactatacagaatgctaacctgcgcgccttcgctgccggagtcacgccggagcaa
tgttttgaaatgctggcggcgatccgtgagaaatacccacagctgcccattggcctgctg
atgtacgcaaacctggtcttctccaacggcattgataacttctattcccgttgccagcag
gttggcgttgattcggtgctggtggccgatgtaccggttgaagagtctgccccgttccgc
caggcggccatgcgacataacgtcgcgcctatattcatctgcccgccaaacgccagtgac
gatttactgcgtgaaattgcttctcacggccgggggtatacctacctgctgtcgcgtgcc
ggggtgaccggttcagaaacccgcgccagtctgccgcttaaacacctggtggataaactg
cgcgaatatcatgcggccccggcgctgcagggctttggcatttccgaagcctcacaggtg
cagcaggcgattgctgccggggcgagaggggcgatttcaggttctgccgtggtcaaaatc
attgagaaacatctgaccgagcctgcggtgatgctgtcagaactgaccgcttttgccgcc
agcctgaaagacggcacccgatgctaa

DBGET integrated database retrieval system