KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01796Help
Entry
EPYR_01796        CDS       T02121                                 

Gene name
trpB
Definition
protein trpB (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:epr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:epr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:epr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1894642..1895832)
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALLQLEDAFISAQSDPSFQAEFTDLLKNYAGRPTALTL
CKNVTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGAATLKDACNEALRDWSGSY
ETTHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILQQEGRLPDAVIACVGGGSNAIGMF
ADFIDESGVELIGVEPGGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTTDGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRANYVSITDEEALDAFKALCRSEGIIPALESSHALAHALKM
ARENPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttaaacccttattttggcgagtttggtggcatgtacgtgccgcagatcctg
atgcctgccctgcttcaactggaagatgcgtttatcagcgcgcagagcgatccctcattc
caggccgaatttaccgacctgctaaaaaattacgctggccgcccaaccgcgctgacgctg
tgtaaaaacgtgactaagggcagcaaaacgcgcctttatctgaagcgtgaagacctgctg
cacggcggcgcgcacaaaaccaatcaggtactgggccaggcgctgctggcaaagcgcatg
ggcaaaaacgaaattattgctgagaccggtgccggtcagcacggcgttgcctcggcgctg
gcctgcgcgctgctcggcctgaaatgccgcatctatatgggtgcgaaggatattgagcgt
cagtcgcctaacgtatttcgtatgcgcctgatgggtgcggaggtgatcccggtgcacagc
ggtgccgccacgctaaaagacgcctgtaatgaagcgctgcgcgactggtccggcagctac
gaaaccacccactatatgctgggtacggcggcaggcccgcatccattcccgaccatcgtg
cgtgaattccagcgcatgattggggaggagactaaagctcagatcctacagcaggaaggt
cgcctgccggatgccgtcatcgcctgcgtcggcggggggtctaacgccatcggcatgttt
gccgactttattgatgagtcgggtgtggaactgattggcgtcgagccaggcggtcacggt
attgaaagcggcgagcatggcgctccgctcaagcacgggcgcgtcggtatttattttggt
atgaaatcaccgatgatgcagaccacagacgggcaaattgaagagtcttattctatttca
gccggtctcgacttcccttcagtcggcccgcagcatgctcaccttaacagtatcggccgg
gcgaactacgtctcgattaccgatgaagaagcgctggatgccttcaaggcgttgtgccgc
agcgaagggatcatcccggcgctggaatcctcacatgcgctggcccatgcgctgaaaatg
gcacgcgaaaatcctgaaaaagagcagctgctggtggtcaatctttccggccgtggtgac
aaagatattttcaccgtgcacgacatccttaccgctaagggagaaatctga

DBGET integrated database retrieval system