KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01797Help
Entry
EPYR_01797        CDS       T02121                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01130  Biosynthesis of antibiotics
epr01230  Biosynthesis of amino acids
Module
epr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EPYR_01797 (trpC)
Enzymes [BR:epr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EPYR_01797 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     EPYR_01797 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: CAY74177
UniProt: D2TAJ8
Position
complement(1895847..1897208)
Genome map
AA seq 453 aa AA seqDB search
MQETILDRIVRDKAVWLAARQQQQPLASFQNDIVPATRSFYDALKGARTAFILECKKASP
SKGVIREDFDPAVIAGVYRHYASAISVLTDEQYFQGNFDFLAIVSAAVSQPVLCKDFIIS
PYQIHLARYYQADAILLMLSVLDDEQYRQLATVAHSLNMGVLTEVINDEELKRATSLGAK
VVGINNRDLRDLSIDLDRTRRLAPAVAHNVTVISESGINSHAQVRELSHFANGFLIGSAL
MSEDNLAAAVRRVMLGENKVCGLTRPQDARSALECGAIYGGLIFAAGSPRQIDAVQAQQV
IAAAALQYVGVFRNDSVGDIVTIARHLNLHAVQLHGDENRDFISQLRAALPENVQIWKAF
SISTRLPARDWPHVDRYVFDQGNGGSGKAFDWSLLKGEKLDNVLLAGGLSADNCVVAAQQ
GCAGLDFNSGVESAPGIKDAAKMASVFQTLKAW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccatacttgaccgaatcgtgcgcgataaagccgtctggctggcggcacgc
cagcagcagcagccgctggcctcgtttcagaatgatatagtcccggccacgcgcagtttc
tacgatgccctgaagggcgcccgtaccgcatttattctggagtgcaaaaaagcctcgccg
tccaagggagtgatccgagaggacttcgacccggcggtgatcgccggcgtgtaccggcat
tacgcctccgcgatttccgtgctgaccgatgagcagtactttcaggggaactttgacttt
ctcgccatcgtcagtgcggcagtcagccagccggtgctgtgcaaggactttattatcagt
ccgtatcagatccatctggcgcgctattatcaggcagacgccattctgctgatgctgtcg
gtactggacgatgagcagtatcgccagctggccaccgtggcacacagcctgaatatgggc
gtgctgacggaagtcatcaacgatgaagagcttaagcgcgccacctcgctgggcgctaaa
gtggtcggcatcaataaccgcgatttgcgcgatctgtcgatcgaccttgaccgcacccgc
cgcctggcgcctgccgtggcgcataacgtcacggtcatcagtgaatccggtatcaatagc
catgcccaggtacgcgagctaagtcatttcgccaacggcttcctgataggttcggcgctg
atgtctgaagataatcttgccgctgccgtcaggcgggtgatgctcggcgagaacaaggta
tgcggactgacccgcccccaggatgcgcgcagtgcgctggagtgcggggctatctatggc
gggctgatcttcgccgccggctcgccgcgccagattgacgcagtgcaagcccagcaggtg
atcgccgccgctgcgctgcagtatgttggcgtattccgcaacgacagcgtgggtgacatt
gtcactattgcccggcacctcaacctgcacgcggtacagctgcacggcgacgaaaatcgc
gatttcatcagccagctgcgtgccgcgctgcctgaaaatgtgcagatctggaaagccttc
agcatcagcacccgcctgcccgcacgcgactggccgcacgtcgatcgctacgtctttgac
caggggaatggcggcagcggtaaagcattcgactggtcgctgttaaagggtgaaaagctg
gataacgtcctgctggccggtggcctgagtgcggataactgcgttgtggccgcacagcag
ggctgtgccggtctcgactttaattccggcgtggagagcgctccagggatcaaagatgca
gctaaaatggcttccgtcttccagacgctgaaagcctggtga

DBGET integrated database retrieval system