KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02295Help
Entry
EPYR_02295        CDS       T02121                                 

Gene name
ycfO
Definition
glycosyl hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EPYR_02295 (ycfO)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    EPYR_02295 (ycfO)
Enzymes [BR:epr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EPYR_02295 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2377765..2378799)
Genome map
AA seq 344 aa AA seqDB search
MMGPVMLDVLGCELNAEEREILQHPLTGGLILFSRNYHDPAQLRELVRQIRSASRHRLVV
AVDQEGGRVQRFREGFTRLPAMQAFAALNPSTEAEKLAQQAGWLMASEMIAMDIDISFAP
VLDIGHGSAAIGERSFHEDPAIALRLARCFIRGMHEAGMKTTGKHFPGHGAVSADSHKET
PRDTRSEAEIRQHDMPIFQQLIAEQALDAIMPAHVIYTQVDPRPASGSPHWLKTVLRQEL
GYDGVIFSDDLSMEGAAIMGSYPERARAALDAGCDMILVCNNRAGAVSVLDNLPVMVSER
VARLYHRGNLTRQQLIDSPRWKETSAALARLQDRWLTHKAGEGS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtccggtaatgttagacgtgctcggttgcgagctgaatgcggaagaacgtgaa
atcttacagcatccgctgacggggggactgatcctgttcagccgcaactatcacgatccg
gcgcagctgcgggagctggtgcgccagatccgcagtgcatcgcgtcatcgtctggtggtg
gcggtggatcaggaaggcgggcgcgtacagcgcttccgtgaaggatttacccggctgccc
gccatgcaggcgtttgcggcgcttaacccatcgactgaggccgaaaagctggcgcagcag
gctggctggctgatggcgtcagagatgatcgccatggatattgatatcagctttgctccg
gtactggacattggccacggcagcgcggctatcggcgagcgctcattccatgaagatccg
gccatcgccttacggctggctcgctgttttattcgcgggatgcacgaagcaggcatgaaa
accaccggcaagcattttcccgggcatggtgccgtcagtgcagattcacataaagagact
ccgcgcgacacgcgcagcgaagcggaaatccgccagcatgatatgccgatctttcagcag
ctgatagcggaacaggcgctggatgccattatgcccgcccacgttatctatacgcaggtg
gacccgcgtcctgccagcggctccccgcactggttaaaaaccgtgttgcgtcaggagctg
ggctatgacggcgtgattttctccgacgatctgtcaatggagggcgcagcgattatgggc
agctaccccgagcgcgcccgggccgcgctggacgccggatgcgatatgatcctggtgtgt
aataaccgggctggcgcggtcagcgtgttggataatctgccggtgatggtgtctgaaagg
gttgcccggctgtaccaccgggggaaccttacccggcaacagcttatcgactcaccgcgc
tggaaggaaaccagcgccgcgttggcccggctacaggatcgctggctaacccataaagcg
ggtgaaggcagctaa

DBGET integrated database retrieval system