KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02616Help
Entry
EPYR_02616        CDS       T02121                                 

Gene name
galM
Definition
galactose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:epr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:epr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2677031..2678065
Genome map
AA seq 344 aa AA seqDB search
MLTSGSSTADGSGCRITTLHNGNGMVATFMDQGATWLSARVPMGDGSVREALLGCASPSD
YARQSAYLGATVGRYANRIAYAQFHYQGTPLPLLANQGQHQLHGGPDGFNQRRWQVVSHS
NSEVEYRLESTDGDQGFPGRLSVSLCYRLDDDNALSISYHASVDRPCPVNLTNHAYFNLD
GVQGDARQHRLLIKADRYLPVDSEGIPNAPLKAVDGTSFDFRREKSLAQDFMQDDDQRAV
QGYDHAFLLNAAAGEAAASLWSADGKLRLDVFTSAPALQLYSGNHLAGTPARDRGVYDSF
QGIALESEFLPDSPNHPEWPQPDCWLQPGESYQSVTRYQLTALD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtccgggtcatccacagctgacggttctggctgccggattaccactttgcat
aatggtaacggcatggtcgccacctttatggaccagggtgcaacctggctttctgcccgc
gtgccgatgggcgacggcagcgtgcgtgaagcgctgctgggctgtgcttcaccgtcagac
tatgcacgacagtcggcttacctgggcgctaccgtgggccgctatgccaaccgcattgcc
tacgcgcagttccactatcagggtaccccccttccgctgctggcaaaccagggtcaacac
cagctgcacggcggccctgatggcttcaaccagcgccgctggcaggttgtcagccacagc
aatagcgaagtggagtatcggctcgaatcgacggatggcgatcagggtttccccggcagg
ctgtcagtttcgctgtgctatcgccttgacgacgataatgcgctgtcaataagctatcac
gcctcggtagacagaccctgcccggttaatctcaccaatcatgcctattttaatctggat
ggcgttcagggtgatgcgcgccagcatcgccttttaatcaaagcagatcgctatctgccc
gttgacagcgaaggcattcccaacgcaccgttgaaagccgtggacggcaccagcttcgat
tttcgccgggaaaaaagcctggcacaggattttatgcaggatgatgaccagcgtgcagtg
cagggttacgatcacgctttcctgctgaacgcggcagcaggcgaagcggccgcctcgctt
tggtctgctgacggcaaattacggctggatgtgttcaccagcgctccggcgttacagctg
tacagcggcaatcacctggcagggactccggcgcgcgataggggtgtttatgattctttt
cagggtattgcactggaaagcgagttcttgcccgattcgcctaaccacccagagtggccg
cagccagactgctggctacagcccggtgaatcgtatcagtcggtgacgcgctatcagctg
acggcacttgactga

DBGET integrated database retrieval system