KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02617Help
Entry
EPYR_02617        CDS       T02121                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_02617 (gpmA)
   01230 Biosynthesis of amino acids
    EPYR_02617 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_02617 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EPYR_02617 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EPYR_02617 (gpmA)
Enzymes [BR:epr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EPYR_02617 (gpmA)
Exosome [BR:epr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EPYR_02617 (gpmA)
  Exosomal proteins of melanoma cells
   EPYR_02617 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678219..2678971
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLSAEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIRHYYLGDADEIAAKA
ADVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggttttaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtagagaagtcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggttaagcagtggcgtcgtggctttgcc
gttaccccacctgagctggatcgtgccgatgagcgtttccccggtcacgatcctcgctat
gcttcgttgtccgctgaacagttgccgacgaccgaaagcctggcgctgaccattgaccgc
gtgctgccatactggaatgaatctattctgccgcgtatgaaaagcggagagaaagtgatc
attgccgcgcacggtaactccttgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaatatcccgactggcgtaccgctggtctatgagttcgatgaa
aactttaagccgatcagacactactacctgggcgatgcagatgaaatcgccgctaaggca
gctgacgtagctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system