KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02639Help
Entry
EPYR_02639        CDS       T02121                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_02639 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EPYR_02639 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EPYR_02639 (sucB)
Enzymes [BR:epr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EPYR_02639 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705643..2706860)
Genome map
AA seq 405 aa AA seqDB search
MSSVEIVVPDLPESVADATVATWHKKTGDSVKRDEVLVEIETDKVVLEVPASADGVLEAI
LEDEGATVISRQALGRLKEGNSGGKETSAKAEVNESTPAQRQTASLEEESNDALSPAIRR
LIAEHSLDPAAIKGSGVGGRITREDVEKHLAQAPAAKAKPEAAEAAAPAGLANRSEKRVP
MTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMALRKQYGEAFEKRHGVRLGFMSFYIK
AVVEALKRYPEVNASIDGTDVVYHNYFDVSIAVSTPRGLVTPVLKDVDALTMADIEKKIK
ELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNG
QVVIQPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPARLLLDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagaaatcgttgttcctgacctgcctgaatccgtggctgacgccaccgta
gccacctggcacaaaaaaaccggcgacagcgtcaagcgcgatgaagtgctggtggaaatc
gaaaccgataaagtggtgttggaagtaccggcttctgccgacggcgtgctggaagcaatc
ctcgaagatgaaggtgccacggtgatttcccgccaggcgctgggccgcctgaaagagggc
aacagcggcggtaaagagacctctgccaaagccgaggtcaatgaatcgacgcccgcacag
cgccaaacggcttcactggaagaagagagcaatgatgctctcagcccggccatccgccgc
ctgattgccgagcacagcctcgatcctgcagcaattaaaggcagcggtgtcggtggacgc
atcacccgtgaagacgtggaaaaacatctggcgcaggctccggcggcaaaagctaaacct
gaagcggcagaagccgctgcgccagcgggtctggcgaatcgcagtgaaaaacgcgtgccg
atgacccgtctgcgcaagcgcgtagccgaacgtctgctggaagcgaaaaacagcaccgcg
atgctcaccacattcaatgaagtgaatatgcagccgattatggcgctgcgtaagcagtat
ggtgaagcattcgaaaaacgtcacggcgttcgcctgggctttatgtccttctacatcaag
gccgttgttgaggcgctgaagcgttatccggaagtgaatgcctcaatcgacggtacggat
gtggtttatcacaactactttgacgtcagtattgccgtctccacgccacgcggtctggtt
accccggtgctgaaagatgttgatgcgctgactatggctgacattgagaaaaaaatcaaa
gagctggcggtgaaagggcgtgacggcaaactgaccgttgatgaactgaccggtggcaac
ttcactatcactaatggtggtgtctttggttcactgatgtccacgccgattatcaacccg
ccacagagcgctatccttggcatgcatgcgatcaaagatcgcccgatggcggtcaacggg
caggtggtgatccagccaatgatgtatctggcgctctcttacgatcaccgtttgatcgat
ggccgtgaatccgttggctatctggtggcgatcaaagagctgctggaagatccggctcgt
ctgctgttggacgtctaa

DBGET integrated database retrieval system