KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02643Help
Entry
EPYR_02643        CDS       T02121                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00020  Citrate cycle (TCA cycle)
epr00190  Oxidative phosphorylation
epr00650  Butanoate metabolism
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01120  Microbial metabolism in diverse environments
epr01130  Biosynthesis of antibiotics
epr01200  Carbon metabolism
Module
epr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
epr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
epr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EPYR_02643 (sdhD)
   00650 Butanoate metabolism
    EPYR_02643 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EPYR_02643 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAY75023
UniProt: D2T381
Position
complement(2712413..2712760)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGSLTYDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaacggcattcatgactggctgctgctgcgt
gccgccgctatgataatgaccctttacgtgttgtatatcctcgcttttatcgtcatgtca
ggctccctgacctatgatatctggcgtggtttttttgcctcatcctttactaaagtcttc
acccttctgacgctgttctccatcctggtgcacggctggattgggatgtggcaggtactg
accgactatatcaaaccactggcgctacgcatgatgctgcagctggtcgtcgtggtagca
ctgttggtgtatgccatttatggaactgttgtagtgtggggtgcataa

DBGET integrated database retrieval system