KEGG   Erwinia pyrifoliae DSM 12163: EPYR_02643Help
Entry
EPYR_02643        CDS       T02121                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EPYR_02643 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EPYR_02643 (sdhD)
   00650 Butanoate metabolism
    EPYR_02643 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EPYR_02643 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2712413..2712760)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGSLTYDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaacggcattcatgactggctgctgctgcgt
gccgccgctatgataatgaccctttacgtgttgtatatcctcgcttttatcgtcatgtca
ggctccctgacctatgatatctggcgtggtttttttgcctcatcctttactaaagtcttc
acccttctgacgctgttctccatcctggtgcacggctggattgggatgtggcaggtactg
accgactatatcaaaccactggcgctacgcatgatgctgcagctggtcgtcgtggtagca
ctgttggtgtatgccatttatggaactgttgtagtgtggggtgcataa

DBGET integrated database retrieval system